KEGG   Rattus norvegicus (rat): 303380Help
Entry
303380            CDS       T01003                                 

Gene name
Slfn2
Definition
(RefSeq) schlafen 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AlbA_2 B3R
Motif
Other DBs
NCBI-GeneID: 303380
NCBI-ProteinID: NP_001100501
RGD: 1308645
Ensembl: ENSRNOG00000037113
Vega: OTTRNOG00000000468
UniProt: D4A2D6
Position
10q26
AA seq 381 aa AA seqDB search
MGAGLHAAEQDNHRAHRKGTGQQNAKAAGKMGISVDLEAEYAKLGLNLGAITLGEKDRRK
MKNSHLRKKENENISLAVCALLNSGGGAIKVKIENENYSLTRDGLGLDLETSLCKCLPFV
QWYLDFTESKGYIYIYVRAWSQEIFGLPIGTLSTNLYVRVVSSSVQVSADAALQFLQDLE
EAGGRPRVRPELPARKACPGVEGECHQEDLAAAFFNKTEFQYEETFFFTRSRYVEVTSLS
VKRLRKRIREILPRTVSAFANTDGGYLFIGLDGKKQQIIGFEAEKSDLVHLESEIEKCIR
QLPVTHFCEEREKIKYTCKFMEVHKPGAACSYVCALRVERFCCAVFAAEPESWHVEDSCV
KRFAAEDWVRLQMGSREAWKR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctggacttcatgcagctgagcaagacaaccacagagctcacaggaagggcact
gggcagcaaaatgcaaaagctgctgggaaaatgggcatcagcgttgacctggaagctgag
tatgctaagctgggtctaaatctaggagcaatcactcttggagagaaggataggaggaaa
atgaagaactctcacctcaggaaaaaggagaatgagaacatctctctggctgtgtgtgct
ctcctgaattcaggaggtggagcaatcaaggttaaaattgaaaatgaaaattatagtctc
actagggatggcctgggactagatttggaaacctctctttgtaaatgtctcccgtttgtc
cagtggtacctggacttcactgagagcaaaggctacatttatatctacgtgagagcatgg
agtcaggaaatctttgggctgccgattggcaccctgagcaccaatttgtacgtaagggtc
gtttcatcctccgtacaagtgagcgctgatgctgcgctacaatttctccaggacctggag
gaagctggagggagaccccgtgtcagaccagagttgcctgcaaggaaagcctgccctgga
gtggaaggagaatgtcaccaggaggatttggctgctgcattttttaacaagaccgaattt
cagtatgaggaaactttcttctttaccaggtccaggtatgttgaagttacatcactttca
gtgaaacgcctgcgaaaacgcatcagagagatcctccctcgaactgtttctgcattcgca
aacacggatgggggatatttgttcattggcttggatgggaaaaaacagcaaataattggc
tttgaagcagagaagagcgaccttgtgcatctagagagtgaaatagaaaagtgcatccga
cagctgcctgtcactcacttctgtgaggagagggagaagatcaagtacacgtgcaaattc
atggaagtgcacaaacccggagccgcgtgttcatacgtgtgtgcgctccgagtggagaga
ttctgctgtgcagtgttcgctgcagagcccgaatcctggcacgtggaagacagctgtgtg
aagaggtttgccgcagaggactgggttaggctccagatgggttccagggaagcttggaaa
aggtga

DBGET integrated database retrieval system