KEGG   Rattus norvegicus (rat): 303393
Entry
303393            CDS       T01003                                 

Gene name
Cox7b
Definition
(RefSeq) cytochrome c oxidase subunit 7B
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    303393 (Cox7b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    303393 (Cox7b)
  09159 Environmental adaptation
   04714 Thermogenesis
    303393 (Cox7b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303393 (Cox7b)
   05012 Parkinson disease
    303393 (Cox7b)
   05014 Amyotrophic lateral sclerosis
    303393 (Cox7b)
   05016 Huntington disease
    303393 (Cox7b)
   05020 Prion disease
    303393 (Cox7b)
   05022 Pathways of neurodegeneration - multiple diseases
    303393 (Cox7b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    303393 (Cox7b)
SSDB
Motif
Pfam: COX7B
Other DBs
NCBI-GeneID: 303393
NCBI-ProteinID: NP_877971
RGD: 727789
Ensembl: ENSRNOG00000054689
Vega: OTTRNOG00000001769
UniProt: P80431
Position
Xq22
AA seq 80 aa
MLPLAKNALSRLQVRSIQQVVARQSHQKKTPTFHDKYGNAVLAGGSIFCISAWTYTATQI
GIEWNLSPVGRVTPKEWRDQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgttgcccttggccaaaaacgcactaagtcgtctccaagttcgaagcattcagcaagtg
gtggcaaggcagagccatcagaagaagacacctactttccatgacaaatatggaaatgct
gtattagcaggtggaagcatcttctgtatttctgcatggacatatacagccacacaaatt
ggaatagaatggaacctgtcccctgttggcagagtcaccccaaaggaatggagagatcag
tag

DBGET integrated database retrieval system