KEGG   Rattus norvegicus (rat): 303394
Entry
303394            CDS       T01003                                 

Gene name
Usp32
Definition
(RefSeq) ubiquitin specific peptidase 32
  KO
K11837  ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    303394 (Usp32)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    303394 (Usp32)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     303394 (Usp32)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   303394 (Usp32)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    303394 (Usp32)
SSDB
Motif
Pfam: UCH DUSP UCH_1 Ubiquitin_3 Ubiquitin_2 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 303394
NCBI-ProteinID: NP_001100502
RGD: 1306657
Ensembl: ENSRNOG00000027711
UniProt: D3ZBB7
Position
10q26
AA seq 1431 aa
MSQHCFIREVLGDGVPPKVAEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDS
DTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEVC
FKVFDIDRDGVLSRVELKDMVVALLEVWKDNRTDDIPMGHLTLEDYQIWSVKNVLANEFL
NLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKY
DANPVVIEPSSVLNGGKFSFGTTAHPIEHGEDRISNNLSYMNTTEEKYSDNISSASEASE
STGSGFLYSATPGADMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQE
PVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGSNLALPRPVIKNSKTDIP
ELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHE
YLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEM
SFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNR
TNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFL
LDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKC
KTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRLNMDEKYTGLKKQL
SDLCGLKSEQILFAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPIPASPVSACSPIQTD
CSSSPSTNGLFTVTTNGDLPRPIFIPNGMPNTVVPCGTEKNATNGIVNGHMPPLPDDPFT
GYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPL
PPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNA
CIAVDWDPTALHLRYQTSQERVVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEM
YYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLV
PRDPTLCQHKPLTPQGDDVSELPIPAGDVKKVDVQNPAGEEDVLLSKSPSSLSANITSSP
KGSPSSSRKSGASCPSSKNSSPNSSPRTLGRNKGRLRLPQIGSKNKLSSSKENLDASREN
GAGQICELADTLNRGHVLGGSQPELVTPLDHEITLANGFLYEHETCGNGYSNGQLGNHSE
EDSTDDQREDTHSKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDE
IDTDSAYILFYEQQGIDCAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4296 nt   +upstreamnt  +downstreamnt
atgagccagcactgcttcatcagggaagtgcttggggatggagtccctcctaaagttgct
gagggtgaaaaggtaaactatgaaaaattcagaaattggcttcttctcaacaaagatgct
tttaccttctctcgatggctgttgtctgggggtgtatatgtgaccctcactgatgacagt
gacactcctactttctaccaaactttggctggagtcacacatttggaagagtcagacatc
attgatctggagaaacgctattggctactgaaggcccaatcccgtactggacgttttgac
ttagagacctttggtccattggtttcaccacctattcgcccttctctgagtgaagtttgt
ttcaaggtgtttgatattgaccgtgatggagttctctccagggttgaactgaaagacatg
gtggttgctcttttagaggtctggaaagataaccgcactgatgatattcctatgggccat
cttactctcgaagactatcagatatggagtgtgaaaaatgttcttgccaatgagtttttg
aatctcctcttccaggtatgccacatagttctggggttaagaccagctactccagaagaa
gaaggacaaattattagaggatggttagaacgagaaagcaggtatggtctgcagccagga
cacaattggtttatcatctccatgcagtggtggcaacagtggaaagaatatgtcaaatac
gatgccaaccctgttgtaattgagccatcatctgttctaaatggaggaaaattttcattt
ggaacaacagcacatcctatagaacatggagaagatagaatcagtaacaaccttagttat
atgaataccacagaagaaaaatactcagacaacatttcttctgcatctgaagcctcagag
tctactggcagtggatttctgtattctgccacaccaggggcagatatgtgctttgcaagg
caacataacacttctgacaataacaaccagtgtttgctaggagccaatgggaatatcctt
ttgcaccttaatcctcagaagccaggagctatcgataaccaaccactagtaactcaggaa
ccagtaaaggctacatcattaacactagaaggaggacgattaaaacgaactccacagcta
atccatggaagagattatgaaatggtcccagaacctgtgtggagagcactttatcattgg
tatggatcaaacctggccctccctagaccagtaatcaagaatagcaaaacggacatccca
gaactggagttatttcctcgctatcttctcttccttcgacagcagcctgccacacggaca
cagcagtctaacatctgggtgaatatgggaaatgtaccctctccaaatgcgcctctaaag
cgggtgttagcctatacaggctgttttagtagaatgcaaaccatcaaggaaattcatgaa
tatctgtctcaaaggcttcgtattaaagaggaagatatgcgactgtggctatacaatagt
gagaactacctgactcttctggatgatgaggatcataggttggaatatttgaaaatccag
gatgagcagcacctggtaattgaagttcgcaacaaagatatgagttggcctgaagaaatg
tcctttatagcaaacagtagcaaaatagatagacataaagttcccacagaaaagggcgcc
acaggtctgagtaacctgggaaacacatgcttcatgaactccagcatccagtgtgttagt
aacacacaaccactgacacagtactttatctcagggagacatctttatgaactcaacagg
acaaatcccattggtatgaaaggccatatggctaaatgctatggagatttggtgcaggaa
ctttggagtggaactcagaaaaatgttgcccccttaaagcttcggtggaccatagcaaaa
tacgctcccaggtttaatgggttccagcagcaagactcccaagaacttctggctttcctc
ttggatggtctccatgaagatctcaaccgagtccacgagaaaccatatgtggaactaaag
gacagtgatggccgacctgactgggaagtggctgcagaggcctgggacaaccatctaagg
agaaatagatcaattgttgttgacttgttccatggtcagctaagatcccaagtcaaatgc
aagacatgtgggcatataagtgttcgattcgacccttttaattttttgtctttaccacta
ccaatggacagttacatgcatttagaaataacagtaattaaattagatggtaccaccccc
atacgatatggactaagattgaatatggatgaaaagtacacaggtttgaaaaagcagctg
agtgatctctgtggacttaaatcagaacaaatcctttttgcagaagtgcatagttctaac
ataaagaacttccctcaggacaaccaaaaagttcgactctcagtgagtggatttttgtgt
gcatttgaaattcctattcctgcatctccagtttcagcttgcagtccgattcaaacagat
tgctcctcttctccatctacaaatggactgttcaccgtgactaccaatggggatctgcct
cgacctatattcatccccaatggaatgccaaatacagttgtaccatgtggaactgagaag
aatgccaccaacggaatagtgaatggtcatatgccacctcttcctgatgacccctttaca
ggctacatcattgcagtccaccgaaaaatgatgaggacagaactgtacttcctgtcatct
cagaagaatcgccccagtctctttggaatgcccctgattgttccatgcactgtgcatacc
cggaagaaagatctctatgatgcagtttggattcaagtatctcgattggccagtccactc
ccacctcaggaagccagcaatcatgcacaggattgtgatgacagcatgggctatcaatat
ccattcactctccgggttgtacagaaagatggaaattcctgtgcctggtgtccatggtat
agattttgcagaggctgtaaaatcgattgtggagaagacagagctttcattggaaatgcc
tgtattgctgtggattgggaccctacagcccttcacctccgctatcaaacatcacaggaa
agagttgtagaggagcatgaaagcgtggagcagagtcggcgagcacaagctgagcccatc
aacctggacagctgtctccgtgccttcaccagtgaggaggaactgggggaaaatgagatg
tactactgctccaagtgtaaaactcactgtttggcaaccaagaagctggacctctggagg
cttcctccaatcctgattattcaccttaaacgatttcagtttgtaaatggacggtggata
aaatcacagaaaattgttaaatttcctcgtgaaagttttgaccctagtgcttttctagta
ccaagagacccaactctttgccagcataaaccactcacaccccagggtgatgacgtctct
gagctaccgatcccagcaggagatgtgaagaaagtggatgtccagaatccagcaggggag
gaggatgtactcctgagcaagagcccgtcttcactcagtgcaaatatcaccagtagccca
aaaggttcaccttcttcatcaagaaaaagtggagccagctgtccctccagcaaaaatagc
agccctaacagcagcccacggaccctggggagaaataaagggaggcttcggctgcctcaa
attggaagcaaaaataaattgtccagtagtaaggagaatttggatgccagcagagagaat
ggggctgggcagatctgtgaactggctgacaccttgaaccgaggacatgtgttgggaggc
agccagcctgagctggtcactcctctagatcatgagatcactttagctaatggatttctt
tatgagcatgagacatgtggcaatggctatagcaatggtcagcttggaaaccatagtgaa
gaagacagcactgatgaccaaagagaagatacacacagtaaacctatttataatctatat
gcaatttcgtgccattcaggaattctgggtgggggccattacgtcacttatgccaaaaat
ccaaactgcaagtggtactgttacaatgacagcagctgtaaggaacttcaccccgatgag
atagacaccgactctgcctacatccttttctatgagcagcaggggatagactgtgcacaa
tttctgccaaagatagatggcaagaagatggcagacacaagcagcatggatgaagacttt
gaatctgactacaagaagtactgtgtgctacagtaa

DBGET integrated database retrieval system