KEGG   Rattus norvegicus (rat): 303407Help
Entry
303407            CDS       T01003                                 

Gene name
Gdpd1, RGD1311813
Definition
(RefSeq) glycerophosphodiester phosphodiesterase domain containing 1
  KO
K22387  lysophospholipase D [EC:3.1.4.39]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    303407 (Gdpd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     303407 (Gdpd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDPD GDPD_2 Chal_sti_synt_N
Motif
Other DBs
NCBI-GeneID: 303407
NCBI-ProteinID: NP_001037703
RGD: 1311813
Ensembl: ENSRNOG00000060561
UniProt: Q0VGK4
Position
10q26
AA seq 314 aa AA seqDB search
MSSTAAFCLLSTLGGYLVTSFLLLKYPALLHQRKKQRFLSRHISHRGGAGENLENTMAAF
QHAVTIGTDMLELDCHITKDEQVVVSHDANLKRSTGVNVNVSDLKYCELPPYLCKLDVPF
QRACKCEGTDTRIPLLKEVFEAFPETPINIDIKVNNNVLIQKVSELVKQYKREHLTVWGN
ASSEIVDKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKE
PHIISKGHKFLIWLSDTLLMRKALFDHLTARGIQVYIWVLNEEHEYKRAFDLGATGVMTD
YPTKLKEFLNNMSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaccgcggctttttgccttctctctactctgggagggtatttggtcacctcg
ttcttgttacttaaatacccagcgttgctccaccagagaaagaaacagcgattcctcagt
aggcacatctctcaccgcggaggtgctggagaaaacctggagaacacaatggctgccttc
cagcacgcagttaccattgggacggacatgttagaactggactgccatatcacaaaagat
gagcaggttgtagtgtcacatgatgcaaatctgaagaggtcaactggggtcaatgtaaac
gtctctgatctcaaatactgtgagctcccaccttacctttgcaaactggatgtcccattt
cagagagcatgcaagtgtgaaggaacagatacccggattcccttgctgaaggaagtgttt
gaggcctttcctgagacccccattaacatcgacatcaaagtgaacaacaacgtgctgatt
cagaaggtctcagaactggtgaagcagtacaagcgcgaacacctgacagtgtggggcaat
gccagctctgagattgtagacaagtgttacaaagagaactcagatatccctatcctcttc
agcctgcagcgtgttctgctcatccttggccttttcttcactggcctcttgccctttgtg
cccattcgagagcagttctttgagatcccaatgccctccatcatactgaagctaaaagaa
ccgcacattatatccaaaggtcataagtttctcatctggctttcggacaccttattaatg
cggaaagctttatttgaccacctcaccgcccggggcattcaagtatacatttgggtttta
aatgaagagcatgagtacaaaagagcttttgatttgggggccacgggagtgatgacggac
tatccaacgaagcttaaggagttcttaaataacatgtcagcatga

DBGET integrated database retrieval system