KEGG   Rattus norvegicus (rat): 303412
Entry
303412            CDS       T01003                                 

Gene name
Rnf43, RGD1305204
Definition
(RefSeq) ring finger protein 43
  KO
K15694  RING finger protein 43 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303412 (Rnf43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    303412 (Rnf43)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     303412 (Rnf43)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    303412 (Rnf43)
SSDB
Motif
Pfam: ZNRF_3_ecto zf-RING_2 zf-RING_11 zf-C3HC4_2 zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_5 Prok-RING_4 FANCL_C zf-ANAPC11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 303412
NCBI-ProteinID: NP_001129393
RGD: 1305204
Ensembl: ENSRNOG00000007606
UniProt: D3ZP81
Position
10q26
AA seq 782 aa
MSGGHQLQLAVLWPWLLMATLHAGFGHTGLVLAAAVESERSAEQKAIIRVIPLKMDPTGK
LNLTLEGVFAGVAEVSPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCL
SLASKARMAGERGASAVLFDITEDRSAAEQLQQPLGLTKPVVLIWGSDAEKLMEFVYKNR
KAYVWIELKEPPAWANYDVWILLTVVGTVFVIILASVLRIRCRPHPSRPDPLQQRTARAI
SQLATRRYQASCRRARAEWPDSGSSSSSAPVCAICLEEFTEGQELRVISCLHEFHRTCVD
PWLHQHRTCPLCMFNIVEGDSFSQALGASPSYQEPGRRLHLIRQHPGHAHYHLPSAYLLG
PSRNSVAQTPRPRPFLPSQEPSMGSRHQRLPRASHLRAPEEQQHLAVSPGHPYAQGWGPN
RLRCTSQHPNACPVALRRARPHESSGSGESYCTERSGYLADGPASDSSSGPCHGSSSDSV
VNCTDISLQGVHGSSSTFRSSLSSDFDPLVYCSPEGALQGKEVQPSMTSRPRSLDSVVPT
GETQVSSHIHYHRHRHHHYKKQFQWHSRKPGLETGVPQSRPAASHTQLEPSLPDQQLTTP
NPAVSSMLPNPQRPRALTEPAPGLAEAVSPSPSPNPSLLNLQKSNLPVRYPQRKRRGGPS
EALPTSQPQDLTVHTACPVPPHYSPSLAYPWPPEVHPLIFRPPGLDRRLLHDVPGPCYSS
SQPVWLYLNPRQPLGPCLPGEGHSKWSFDTPEDRRCPYSHCQVLPAQPGSEEELEELCEQ
AV
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgagtggtggccaccagctgcagctggctgtcctctggccctggctgctgatggcgacg
ctgcatgcaggctttggacacacaggactggtgctggcagcagcggtggagtcggaaaga
tcagcagaacagaaagctatcatcagagtgatccccctgaaaatggaccccacaggaaaa
ctgaacctcaccttggaaggtgtgtttgctggtgttgcagaagtgagtccagcagaaggg
aagctaatgcagtcccaccccttgtacctgtgcaacgccagtgatgacgacaacctagag
cctggcttcatcagcatcgtcaagctggagagtcctcggcgggctcctcgcccctgcctg
tcactggccagtaaggcgcgaatggctggcgagcgaggagccagcgctgtgctctttgac
atcacagaagaccgatcagctgctgagcagctgcagcagcccctggggctgactaagccg
gtggtgctgatctggggtagtgatgcggagaagctgatggagtttgtgtacaagaatcgg
aaggcctatgtgtggattgagctgaaggagcccccggcttgggcaaattacgatgtgtgg
atcctcctgactgtggtgggcacggtctttgtgatcatcctggcttcggtgctacgcatc
aggtgtcgcccccaccctagcagaccggaccctcttcagcagcggacagcccgggccatc
agccagctggccaccaggaggtaccaagccagctgtagacgggctcgagctgagtggcca
gactcagggagcagcagcagctcggcccctgtgtgtgctatctgtctggaagagttcaca
gaggggcaggagctccgggtcatttcctgcctccacgagtttcatcgaacctgtgtggac
ccctggctacaccagcatcggacttgccctctctgcatgttcaacatcgtagagggagat
tcattttcccaagccctgggagcttctccatcctaccaggaaccaggcagaaggctccac
ctcattcgccaacatcctggccacgcccactatcatctcccttctgcctacctgctgggc
ccttccaggaattcagtagcccagaccccaagacctagacccttcctgccctcccaggag
ccaagtatgggctctcggcatcagcgccttcccagggcttcccatctccgggcaccagaa
gagcagcaacacttggcagtatcccctgggcacccctacgcccagggctgggggccaaat
cgcctccgatgtacctctcagcatcccaacgcttgcccagtggccctacggcgggcccgg
cctcatgagagcagtgggtctggagaaagctactgtacggaacgcagtggttacttggct
gatgggccagccagcgactccagctcagggccctgtcatggctcttctagtgactcagtg
gtcaactgcacggacatcagcctgcagggcgtccatggcagcagttctaccttccggagc
tccctgagcagtgactttgaccccttggtatactgtagccctgaaggggctctccagggg
aaagaggtgcaacctagcatgacctctcgaccccgctcgttggactcagtggtacccacg
ggggagacccaggtttccagccacatacactatcaccggcaccgccaccaccactacaaa
aagcagttccagtggcatagcaggaagcctggcctagaaactggggttccacagtccagg
cctgctgcttctcacactcagctggagccatctctccctgaccagcagctcaccacaccc
aacccagcagtttcctcaatgctccccaacccacaacggcccagggcccttacggagcca
gcccctggcctagcagaagctgtcagccctagccccagtcccaaccccagtcttttgaat
ttgcagaaatccaacctccccgtcagatacccacagagaaaacggcggggtggcccctca
gaagccctgccaacctctcagccccaggacttgactgtgcacacagcttgccccgttccc
ccccactacagccccagtctagcatacccttggcccccagaggttcatccattgatattc
agacctccaggcctggataggaggctgctacatgatgtaccaggcccctgttactcaagt
tcacagccagtgtggttgtatctgaatccccgccagcctctgggaccatgcttacctgga
gagggacattccaagtggagttttgacaccccagaggacaggagatgtccttactcacac
tgccaggtgctgccagcccagcctggctcggaagaggagcttgaagagctgtgtgaacag
gctgtgtga

DBGET integrated database retrieval system