KEGG   Rattus norvegicus (rat): 303413
Entry
303413            CDS       T01003                                 

Gene name
Mpo
Definition
(RefSeq) myeloperoxidase precursor
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00983  Drug metabolism - other enzymes
rno04145  Phagosome
rno04613  Neutrophil extracellular trap formation
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    303413 (Mpo)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    303413 (Mpo)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    303413 (Mpo)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    303413 (Mpo)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    303413 (Mpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    303413 (Mpo)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     303413 (Mpo)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   303413 (Mpo)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 303413
NCBI-ProteinID: NP_001100506
RGD: 1592081
Ensembl: ENSRNOG00000008310
UniProt: D3ZGE2
Position
10
AA seq 458 aa
MKLFLALAGLLAPLAMLQTSTGATPALPGEVANSVVLDCMEEAKRLVNKAYKERRESIKQ
SLRSGSASPMELLSYFKQPVAGTRTAVRAADYLHVALDLLKRKLQPLWPRPFNVTGDMRS
SEMPELTSMHTLFVREHNRLATELKRLNPRWNGEKLYQEARKIVGAMVQIITYRDYLPLV
LGPAAMKKYLPQYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNQYRSTGPNPRVP
LSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPAL
NMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQYGTPNNIDIWMGG
VSEPLEPNGRVGQLLACLIGTQFRKLRDGDRFWWENPGVFSKQQRQALATISLPRIICDN
TGITTVSKNNIFMSNSHPRDFVSCNTLPKLNLASWKET
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaagctttttttggccttggcaggcctcctggcccccctggccatgcttcagacttcc
actggtgccactccagcgctcccgggggaagtggcgaactcagtggtgctggactgcatg
gaggaggccaagcggctggtgaacaaagcctacaaggagcggagagaaagcatcaagcag
agtcttcgaagtggctccgccagccctatggaactcctatcgtatttcaagcagccggtg
gcgggcaccaggacagctgtgagggctgccgactatctgcacgtggccctggacctgctg
aagaggaagctgcagcccctgtggccacggcctttcaatgtcacaggggacatgcgctcc
agcgagatgccagagctcacctccatgcacaccctcttcgtgcgagagcataaccgtctg
gccacagagctcaagcgcctgaatcctcgctggaatggggagaagctttaccaggaggcc
cggaagattgtgggggccatggtccagatcatcacataccgagactacctgcccttggtg
ttggggccagcagccatgaagaagtacctaccccagtaccgatcctacaatgactcagta
gaccctcggatcgccaatgtcttcaccaacgctttccgttacggccacaccctcatccaa
cccttcatgttccgcctggacaatcagtaccggtccacaggacccaacccccgtgtccca
ctcagcagggtcttttttgccagctggagagttgtgctggaaggtggcattgaccccatc
ctccgaggcctcatggctactcctgccaaactgaatcgccagaaccaaattgcggtggat
gagatccgggagcgactgtttgagcaggtcatgaggataggtcttgacttacctgccctt
aacatgcagcgcagccgggatcatggcctcccgggatacaatgcctggagacgcttctgt
gggcttccacagcccagcacagtgggtgagctcggcacggtgctgaagaacctggagctg
gcacggaagctgatggcacagtatggcacgcccaacaacattgacatctggatgggcggt
gtgtccgagcccctagagcccaatggccgcgtaggccagctccttgcctgcctcattggc
actcagtttaggaagctacgggatggcgataggttttggtgggagaacccgggtgtgttc
agtaaacagcagagacaggccttggctaccatctccttgccccgcatcatctgtgacaac
actggcatcactaccgtgtctaagaacaacatcttcatgtccaactcacacccccgagac
tttgtgagctgtaacacccttcctaaactgaatctggcttcctggaaggagacctag

DBGET integrated database retrieval system