KEGG   Rattus norvegicus (rat): 303414
Entry
303414            CDS       T01003                                 

Symbol
Epx
Name
(RefSeq) eosinophil peroxidase precursor
  KO
K10788  eosinophil peroxidase [EC:1.11.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    303414 (Epx)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     303414 (Epx)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 303414
NCBI-ProteinID: NP_001100507
RGD: 1311882
Ensembl: ENSRNOG00000008707
UniProt: D3ZSY4
Position
10:complement(72666865..72677952)
AA seq 715 aa
MQLLLALLGVLATFILTQLAEGTVPAPPSPVENSVLQDCIAEAKLLVDTAYNRTQKSIVQ
RLQSGSASPMDLLAYFKQPVAATRRVVQAADYMHVALGLLEEKLQPQESRPFNVTDVLTE
PQLRLLSQASGCALQDQVEKCSNKYRTITGRCNNRRRPWLGASNQALARWLPAEYEDHRS
LPFGWTPGKRRNGFLLPLVRAVSNQIVRFPSKKLTSDQGRSLMFMQWGQFIDHDLDFTPE
SPARVTFNMGVDCEKTCAQLPPCFPIKIPPNDPRIKSQRDCIPFFRSAPACPQNRNKVRN
QINSLTSFVDASMVYGSEVSLALRLRNRTNYLGLLATNQQFQDNGRALLPFDNLHEDPCL
LTNRLVRIPCFLAGDSRASETPKLAALHTLFVREHNRLATELKRLNPHWSGDKLYNEARK
IVGAMVQIITYRDFLPLVLGKARMRRTLGPYRGYCSNVDPRVANVFTLAFRFGHTMLQPF
MFRLDSQYRTSAPNSHVLLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDSMLVDEL
RDKLFQQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNRNLAR
KFLNLYKTPDNIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKWGVFTK
RQRKALRRISLSRIVCDNTGISTVSRDIFRANIYPQGFVSCSRIPKLNLSAWRGK
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgcagctgctgctggccctgttaggggtcttagccacgttcatcctcacacaactcgct
gagggcactgtcccagctccccccagtccagtggagaattcagtccttcaagactgcata
gcagaggcgaagttgctggtggacactgcctacaatcggacacagaagagcattgtgcag
cgtcttcaaagcggctcggccagccccatggacctcctggcctacttcaaacagccagta
gcagccaccagaagagttgttcaggcggctgattatatgcatgtggccttagggctgctg
gaagagaagcttcagcctcaggaatccagacccttcaatgtcactgatgtgctcacagaa
ccgcagctgcgcctgctgtcccaggccagtggctgtgctctccaggaccaggtcgagaag
tgcagcaacaaataccgaactataacagggagatgcaacaacaggaggagaccctggctg
ggagcttccaaccaggccctggcccgctggttaccagctgagtatgaagaccacaggtct
ctccccttcggctggacccctggcaagaggcggaatggcttcctccttcctcttgtccgg
gctgtctccaatcagattgtgcgcttccccagtaagaagctgacctcagaccagggccgg
tccctcatgttcatgcagtggggccagttcatcgaccatgacttggacttcaccccagag
tccccagccagagtgaccttcaacatgggcgtggactgtgagaagacctgtgcccagctg
cctccctgcttccccatcaagataccacccaatgacccccgcatcaagagccagcgagac
tgcatccctttcttccgctctgcccctgcgtgcccccaaaacaggaacaaggtccgtaac
cagattaactcgcttacatccttcgtggacgccagcatggtgtatggcagtgaggtgtcc
ctcgccctgcgacttcgaaatcggaccaactacctggggctcctggccactaaccagcaa
ttccaggacaatggccgagccctactgcctttcgacaacctgcatgaggacccttgtctc
ctgactaaccgattagtacgcatcccgtgcttcctggcaggtgacagtcgggcaagtgaa
acccccaaactggcggccttgcacacgctatttgtgagagaacacaatcgcctagccaca
gagctgaagcgtctgaatccccactggagtggagacaagctgtacaatgaagcccggaag
atcgtgggtgccatggtccagatcatcacctaccgagactttctgcctctggttctgggc
aaggcccggatgagaagaaccttgggtccctacagagggtactgctccaacgtggacccc
cgcgtagccaatgtcttcaccctggctttccgcttcggccacaccatgctgcagcccttc
atgttccgtttggacagccagtaccggacctcagcacccaactcccacgttctgctcagc
tctgctttcttcgccagctggcgtattgtatacgaaggtggcatcgaccctatcctccga
ggtctcatggccaccccagctaagctgaaccggcaagattccatgctggtggatgagctt
cgggacaagttgtttcagcaagtgagaaggatcgggctggatctggcagctctaaacatg
cagcgcagccgggaccacgggcttccaggatacaatgcctggaggcgcttctgtggcctt
tcccagccccgaaacttagcccagcttagtcgggtgctaaaaaatcggaatttggcaagg
aagtttctgaacctgtacaagacgcccgacaacattgacatctgggtgggagccatagca
gagcctcttctgccgggggcccgagtggggcctcttctggcttgtctttttgagaaccag
ttcagaagagcccgagacggagacagattctggtggcagaaatggggcgttttcaccaaa
agacaacgcaaagccctgaggcgaatttctttatctcggattgtgtgcgacaatactggc
atcagcaccgtttcgagggacatcttcagggctaacatctacccacagggttttgtgagc
tgtagccgtattcccaagttgaacctgtcagcctggcgaggcaaatga

DBGET integrated database retrieval system