KEGG   Rattus norvegicus (rat): 303439Help
Entry
303439            CDS       T01003                                 

Gene name
Mmd, Maf
Definition
(RefSeq) monocyte to macrophage differentiation-associated
  KO
K11064  monocyte to macrophage differentiation protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    303439 (Mmd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HlyIII
Motif
Other DBs
NCBI-GeneID: 303439
NCBI-ProteinID: NP_001007674
RGD: 1592079
Ensembl: ENSRNOG00000002436
UniProt: Q719N3
Position
10q26
AA seq 238 aa AA seqDB search
MQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI
TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE
LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE
LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcaggaatcgattccagcgtttcatgaaccatcgggccccagccaatggccgc
tacaaaccaacttgctacgagcatgctgcgaattgctacacacacgcattcctcatcgtt
ccagccattgtgggcagcgccctcctccatcggctgtccgacgactgctgggaaaagata
acagcatggatctacgggatgggcctttgtgccctcttcatcgtctccacagtgtttcac
attgtatcatggaagaagagccacttaagaacagtggagcattgtttccacatgtgtgat
cggatggtcatctacttcttcattgccgcttcctacgccccatggttaaatctccgtgaa
ctcggacccctggcatctcacatgcgttggtttatctggctcatggcagctggaggaacc
atttacgtatttctctaccatgaaaagtacaaagtggtggaacttttcttctatctcacg
atgggattttctccagccttggtggtgacatcaatgaataacactgacggacttcaagag
cttgcctgtgggggcctgatctactgcctgggagtcgtgttcttcaagagcgatggcatc
attccattcgcccatgccatctggcacctgttcgtggccacagccgccgccgtacactac
tatgccatttggaagtatctttaccgaagtcccacggactttattcggcatttgtga

DBGET integrated database retrieval system