KEGG   Rattus norvegicus (rat): 303468
Entry
303468            CDS       T01003                                 

Gene name
Sgca
Definition
(RefSeq) sarcoglycan, alpha
  KO
K12565  alpha-sarcoglycan
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    303468 (Sgca)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    303468 (Sgca)
   05414 Dilated cardiomyopathy
    303468 (Sgca)
   05416 Viral myocarditis
    303468 (Sgca)
SSDB
Motif
Pfam: Sarcoglycan_2 DAG1
Other DBs
NCBI-GeneID: 303468
NCBI-ProteinID: NP_001100509
RGD: 1308062
Ensembl: ENSRNOG00000003998
UniProt: D3ZDQ9
Position
10q26
AA seq 387 aa
MVAAATWIPLLAGLLAGLRDSKAQQTTLHPLVGRVFVHPLEHATFLRLPEHIAVPPTVRL
TYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGTPTPEDRGHQVIEVTAYNRDSFDTTRQRL
LLLIGDPEGPRLPYQAEFLVRSHDVEEVLPSTPANRFLTALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHF
RVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATGRDFLTDALVTLLVPVLV
ALLLTLLLVYIMCCRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTL
PMFNVRTGERLPPRVDSAQMPLILDQH
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggtagcagccgcaacttggattcctctccttgcaggtctcctggcaggcctgagggac
agcaaggcccagcagacaactttacacccacttgtgggtcgtgtgtttgtgcatcctttg
gaacatgctaccttcctgcgccttccagaacacattgcggtgccacccactgtccgactc
acctaccatgctcacctccagggacatccagacctgcccaggtggctgcactacacacaa
cgcagtccctataaccctggcttcctctatggcactcccactccggaagatcgtgggcac
caagtcattgaggtcacagcctacaatcgtgacagctttgacaccactagacagaggctg
ctgctgctgattggggaccccgaaggtcccaggttaccataccaagctgaattcctggtg
cgtagccatgatgtggaggaggtcctgccctccacacctgccaaccgcttcctcaccgcc
ttggggggactctgggagccaggggagctccagttgctcaacatcacctctgccttggac
cgaggaggccgagtccctcttcctattgagggccggaaggaaggggtttacattaaggtg
ggctctgccacacccttttccacctgcctgaagatggtggcatcacctgacagctatgcc
cgttgtgcccagggacagcctccactattgtcctgctatgacaccttggcacctcacttc
cgtgtcgactggtgcaatgtatctctggtggacaagtcagtgccagagcccctggatgag
gtgcctactcctggcgatgggatcttggagcacgacccattcttctgcccgcccactgag
gccacgggccgagacttcctaacagatgccttggtgaccctcttagtgcccgtgctggtg
gctctgctgctcaccctgttgctggtttacattatgtgctgtcggcgtgaaggacggctg
aagagagacatggccacctctgacatccagatgtttcaccactgctccatccacgggaat
acggaagagcttcggcagatggcagccagccgcgaggtgccccggcctctatccaccttg
cccatgttcaacgtgcgtacaggagagcggttacctccccgagtagacagcgcacagatg
cccctcatcctggaccagcactga

DBGET integrated database retrieval system