KEGG   Rattus norvegicus (rat): 303480
Entry
303480            CDS       T01003                                 

Gene name
Hoxb13
Definition
(RefSeq) homeo box B13
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HoxA13_N Homeodomain Homeobox_KN DUF1510 CI-B14_5a
Other DBs
NCBI-GeneID: 303480
NCBI-ProteinID: NP_001100511
RGD: 1309113
Ensembl: ENSRNOG00000007491
UniProt: D3ZWL5
Position
10q26
AA seq 286 aa
MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSSPLASHPAAPTLMPTVNYAPLDLPGSAEP
PKQCHPCPGVPQGASPAPVPYGYFGGGYYSCRVSRSSLKPCAQTATLATYPSETPAPGEE
YPSRPTEFAFYPGYPGPYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQPWALAGGWN
SQMCCQGEQNPPGPFWKAAFAEPSVQHPPPDGCAFRRGRKKRIPYSKGQLRELEREYAAN
KFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKTSTTP
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagcccggcaattatgccaccttggacggggccaaggatatcgaaggcttgctggga
gctggagggggtcggaatttagtcgcccactcctccccactggctagccatcccgcagct
ccaacgctgatgccgactgtcaactatgcccccttggatctgccaggctctgcagagcca
ccaaagcagtgccacccttgtcctggggtgccccagggggcatctccagctcctgtgcct
tatggctactttggaggcgggtactactcttgccgagtatccaggagctcactgaaaccc
tgtgcccagacggccaccctggctacttacccttcggaaacccctgcacctggggaggag
tatcctagccgtcccaccgagtttgccttctatccgggctacccgggaccttaccagcct
atggccagttacctggatgtgtctgtggtgcagaccctgggggcccctggggagcctcgc
cacgactctctgcttcccgtggacagttatcagccttgggccctggccggtggctggaac
agccagatgtgctgccaaggtgaacagaacccaccaggtccattctggaaagcagcattt
gcagagcccagtgtccagcaccctcctcccgacggctgcgccttccgccgcggccgcaaa
aaacgcattccctatagcaaggggcagttgcgagagctggagcgagagtatgcggccaac
aagtttatcaccaaggacaagaggcgcaagatctcggcagccaccagcctctctgaacgc
cagattaccatctggtttcagaaccgccgggtcaaggagaagaaggttcttgccaaggtc
aagaccagcactactccgtga

DBGET integrated database retrieval system