KEGG   Rattus norvegicus (rat): 303514Help
Entry
303514            CDS       T01003                                 

Gene name
Msl1, RGD1564778
Definition
(RefSeq) male specific lethal 1 homolog
  KO
K13163  male-specific lethal 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    303514 (Msl1)
   03036 Chromosome and associated proteins [BR:rno03036]
    303514 (Msl1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    303514 (Msl1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    MSL complex
     303514 (Msl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEHE MSL1_dimer Laminin_I Herpes_UL6 DivIC
Motif
Other DBs
NCBI-GeneID: 303514
NCBI-ProteinID: NP_001100518
RGD: 1564778
Ensembl: ENSRNOG00000009643
UniProt: D3ZBD0
Position
10q31
AA seq 599 aa AA seqDB search
MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDESGAAETHFLPRHRKLKEPGPPLA
STQGGSPAPSPAGCGGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPV
AAGAGCSPRPKYQAVLPIQTGSLVAAAKEPTPWAGDKGGAAPPAATASDPAGPPPLPLPG
PPPLAPTATAGTLAASEGRWKSIRKSPLGGGGGSGASSQAACLKQILLLQLDLIEQQQQQ
LQAKEKEIEELKSERDTLLARIERMERRMQLVKRDNEKERHKLFQGYEPEEREETELSEK
IKLERQPELCETSQALPSKPFSCGRSGKGHKRKTPFGNTERKTPVKKLAPEFSKFKTKTP
KHSPIKEEPCGSISETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEQAFSSE
MEDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVAIPSWRDHSVEPLRDPNPSDIL
ENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFF
PEPDDVESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRLEIQKKQTPHRTCRK
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagatccgcagtgttcaaggcggccgcggcccctgccggcggcaaccccgag
cagcgactggactacgagcgggctgcggctctgggcgggcccgaggacgagtccggggcg
gccgaaacccacttcctcccccggcatcgtaagctcaaggagcccgggcccccgctggcc
tctacccagggcgggagccccgcgccctctccagccggctgcggcggcggcaagggccgg
ggtttgttactcccggccggggcggcccccgggcagcaggaagagagctggggcggttcg
gtgcccttgccctgtccgcccccggctaccaaacaagccggcatcggcggggagccagtc
gcagccggcgctggctgcagcccccggcccaagtatcaggcggtgctgcccattcagacg
ggctctctcgtggcggcggccaaagagcctacgccctgggctggggacaagggtggggcg
gctcccccagctgccaccgcctcggacccggcgggacccccaccactacctctgcccggg
ccgccacccctcgcgcccaccgccactgccgggaccctggcggccagtgagggcagatgg
aagagtataaggaagagccctctcgggggtggcggcggctcgggagcctccagtcaggcc
gcctgcctcaaacagatccttctgctgcaattggacctcatcgaacagcagcagcagcag
ttgcaagccaaggaaaaggagatcgaggagctgaagtcggagagagatacgctccttgct
cggattgaacgtatggaaaggcggatgcagctggtaaagagggataacgagaaggaaagg
cacaagctgtttcagggctatgaacctgaagagagagaggaaacggagttgtctgagaaa
attaaactggagcgccagccggagctctgcgagacatcccaggctctgccttctaagcct
ttctcatgtggccggagtggcaagggacacaaaaggaaaaccccatttggaaatacagaa
agaaagactcctgttaaaaagctggctcctgaattttcaaaattcaaaacaaaaactcct
aagcactctcccattaaagaggagccctgtggttccatatcagaaactgtttgtaaacgt
gaattgaggagccaagaaaccccagaaaagccccggtcttcagtggataccccaccaaga
ctctcgactccccaaaagggacccagcacccaccccaaggagcaagccttctcaagtgag
atggaagatttgccgtacctttccaccacagaaatgtatttgtgtcgttggcaccagcct
cccccatcaccgttaccattacgggaatcctctccaaagaaggaggagactgtagcaatt
ccttcttggagggaccactcagtagagcctctaagggacccaaatccttcagacattttg
gagaacctggatgacagtgtgttttcaaagaggcatgcgaaactggagctagacgagaag
aggagaaaacgatgggatattcagaggatcagggaacaaagaattttacagcgactgcag
ctcagaatgtataaaaagaaaggaattcaggaatctgagcctgaggttacctcatttttc
cctgagcccgatgacgttgaaagtttgatgattacccccttcttgcctgttgtagcattt
ggacggccattaccaaaattaactccacagaactttgaactaccctggttggatgagcga
agccgttgcagattggagatccagaagaagcaaacacctcaccggacttgtaggaagtag

DBGET integrated database retrieval system