KEGG   Rattus norvegicus (rat): 303518Help
Entry
303518            CDS       T01003                                 

Gene name
Smarce1, BAF57, RGD1304726
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
  KO
K11651  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E, member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    303518 (Smarce1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    303518 (Smarce1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    303518 (Smarce1)
   03036 Chromosome and associated proteins [BR:rno03036]
    303518 (Smarce1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     303518 (Smarce1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    303518 (Smarce1)
   PBAF complex
    303518 (Smarce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 Pepsin-I3
Motif
Other DBs
NCBI-GeneID: 303518
NCBI-ProteinID: NP_001020164
RGD: 1304726
Ensembl: ENSRNOG00000010676
UniProt: Q56A18
Position
10q31
AA seq 376 aa AA seqDB search
MSKRPSYAPPPTPAPATASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWE
IGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEE
ESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDV
RSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCG
LKVEVDMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQGSIAPEEEQVANKAEEKKDE
ENIPMETEETHLEDTAENQQNGEEGTSTPEDKESGQEGVDSMEVEGTSDSNTGSESNSAT
VEEPPTDPVPEDEKKE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaagaccatcttatgccccacctcccaccccagctcctgcaacagcgtcctcc
ggcattacaatcccaaagcctccaaagccaccagataagccgctcatgccctacatgagg
tacagcagaaaggtctgggaccaagtaaaggcttccaaccctgacctaaagttgtgggag
attggcaagattattggtggcatgtggcgagatctcactgatgaagagaaacaagaatat
ttaaacgagtacgaagcagaaaagatagagtacaatgaatctatgaaggcctatcacaat
tcccctgcataccttgcatatattaatgcaaaaagtcgtgcggaagctgcattagaggaa
gaaagtcgacagagacagtcgcgcatggagaaaggagagccttacatgagcattcagcct
gcggaggacccagacgattatgatgacggcttttcaatgaagcatacagccactgcccgt
ttccagagaaaccaccgcctcatcagtgagatcctcagtgagagtgtggtacctgatgtg
cggtcggttgtcacaacagctagaatgcaagtcctcaagcgacaggtccagtctttaatg
gttcatcagcggaaactagaagccgagcttcttcagatagaggaacgacaccaggaaaag
aagaggaaattcctggaaagcacagactcctttaacaatgagcttaaaaggctgtgtggt
ctgaaggtggaagtggacatggagaagattgcagcagagatcgcacaggcggaggagcag
gcccgcaaaaggcaggaggagagggagaaggaggcagccgagcaagctgagcgcagccag
ggcagcatcgcccccgaggaagagcaagtggcgaacaaagccgaggagaagaaggatgag
gagaacatcccgatggagacagaggagacacaccttgaagacactgcggagaaccagcag
aatggtgaagaaggcacatctactcctgaggacaaggagagtgggcaggagggggttgac
agcatggaggtggaagggaccagtgacagtaacaccggctcagagagcaacagcgcaacg
gtggaggagccgcccacggaccctgtgccagaagacgagaagaaggaataa

DBGET integrated database retrieval system