KEGG   Rattus norvegicus (rat): 303539Help
Entry
303539            CDS       T01003                                 

Gene name
Kat2a, Gcn5, Gcn5l2
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05166  HTLV-I infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    303539 (Kat2a)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    303539 (Kat2a)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    303539 (Kat2a)
  Infectious diseases
   05166 HTLV-I infection
    303539 (Kat2a)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     303539 (Kat2a)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     303539 (Kat2a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    303539 (Kat2a)
   HAT complexes
    PCAF complex
     303539 (Kat2a)
    STAGA complex
     303539 (Kat2a)
    TFTC complex
     303539 (Kat2a)
    SAGA complex
     303539 (Kat2a)
    SLIK complex
     303539 (Kat2a)
    ADA-HAT complex
     303539 (Kat2a)
    HAT-A2 complex
     303539 (Kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 303539
NCBI-ProteinID: NP_001100520
RGD: 1307242
Ensembl: ENSRNOG00000018364
UniProt: D4ACX5
Position
10q31
AA seq 832 aa AA seqDB search
MAEPSQAPNPAPAAQPRPLQSPAPAPTSTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GGAGVGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKN
PKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMS
VHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSH
LAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSC
DSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEE
EIYGANSPIWESGFTMPPSEGTQLVPRPATVSATVVPSTPIFSPSMGGGSNSSLSLDSTG
TEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAA
RDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFD
PKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
SILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELS
HIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGK
ELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSR
YYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccaaacccggccccggcagcgcagccccggccccttcag
tccccggcccctgccccaacttcgactcctgcgcccagtccggcttcagcccccactccg
gctcctactccggcaccagctcctgccccagctgcagccccagccgggagcacagggact
gggggggccggggtaggaagtggaggggatccggctcgacctggcctgagccagcagcag
cgcgctagccagagaaaggcgcaagtccgggggctgccgcgtgccaagaagcttgagaaa
ctaggggtcttctcagcttgcaaggccaatgaaacctgcaagtgtaatggctggaaaaac
cccaagccccccactgcaccccgcatggacctacagcagccagctgctaacctgagcgag
ttgtgccgcagctgtgagcaccccttggcggaccatgtgtcccacctggagaatgtgtca
gaggatgagattaaccggctcttgggaatggtagtggatgtagaaaatctgttcatgtct
gttcacaaggaagaggacacggacaccaagcaggtctatttctacctcttcaagctcctg
cggaaatgcatcctgcaaatgacacgaccagtggtggagggatccctaggcagcccgcca
tttgagaagcctaacatcgagcagggtgttctgaactttgtgcagtacaaatttagccac
ctggccccccgggagcggcagacaatgttcgagctctcaaagatgttcctgctctgcctt
aactactggaagctggagacccctgctcaattccggcagcgatcccagtctgaggatgtt
gctacctataaggtcaattataccagatggctctgttactgccacgtgcctcagagctgc
gacagcctcccccgatatgagaccacccatgtgtttggccgaagccttctgcggtccatt
tttactgtcacccgccggcagctactggaaaaatttcgggtggagaaggacaaactggtg
cccgagaagaggaccctcatcctcactcacttccccaagttcctgtccatgcttgaggaa
gagatctacggggcgaattcccccatctgggagtcaggcttcaccatgccaccttcggag
gggacacagctggtgccccggccagcgactgtcagtgcaacagttgtacccagcactccc
atcttcagtccttccatgggcggaggcagcaacagctccctgagcctagattccacaggg
acagagcccatgccaggagagaagaggaagcttcctgagaacctgactctggaggatgct
aagcggctccgagtgatgggcgacattcccatggagctggtcaacgaggtcatgctgacc
atcaccgaccctgctgccatgctggggcccgagacgagcctgctttcagccaacgcagct
cgagatgaaacagctcgcctggaagagcgtcgagggatcatcgaattccacgtcattggc
aactctctgacgcccaaggccaaccggcgtgtgctgctgtggcttgtggggctgcagaac
gtcttctcccaccagctgccacgaatgcccaaggaatatattgcccgcctcgtctttgac
ccgaagcataagaccctggccttgatcaaggatgggcgggtcatcggtgggatttgcttc
cgcatgtttcccacccagggcttcacggaaatcgtcttctgtgctgtcacctcaaatgag
caggtcaagggctatggcacccacctgatgaatcacctgaaggagtaccacatcaaacac
agcatcctgtacttcctcacctacgccgacgagtacgccatcggctacttcaagaagcag
ggcttctccaaggacatcaaggtgcccaagagccgatatctgggctacatcaaggactat
gagggagcgaccctgatggagtgtgagctgaacccccgcatcccctacacagagctgtcc
cacatcatcaagaagcagaaggagatcatcaagaagttgattgagcgcaaacaggcacag
atccgaaaggtttaccctggactcagctgcttcaaagaaggagtgaggcagatccctgtg
gagagcgtccctggcattcgagagacaggctggaagccactgggaaaggagaagggcaag
gagctgaaggaccctgaccagctgtatacgaccctcaaaaacctgctggctcagatcaag
tcacaccccagtgcctggcccttcatggaacctgtgaagaagtcggaggcccctgactac
tacgaggttatccgcttccccattgacctgaagaccatgacagaacggttgcgcagccgc
tactatgtgacccggaagctctttgtagccgacctgcagcgggtcatcgccaactgccgg
gagtacaatcccccagacagcgaatattgtcgctgcgccagtgccctggagaagttcttc
tacttcaagctcaaagaaggagggctcattgacaagtag

DBGET integrated database retrieval system