KEGG   Rattus norvegicus (rat): 303552Help
Entry
303552            CDS       T01003                                 

Gene name
Rundc1
Definition
(RefSeq) RUN domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RUN DUF1192
Motif
Other DBs
NCBI-GeneID: 303552
NCBI-ProteinID: XP_001081465
RGD: 1307490
Ensembl: ENSRNOG00000023768
UniProt: F1LVT5
Position
10q31
AA seq 615 aa AA seqDB search
MATVEVATELGTVVTAVGPKAKDEEEEEDEEESLPPCETVRWAPVGAVAEAGPGAATFSE
EAAAEEPGAAPGSPPDATVRTLRRLQAERRQLDSALLALSSHFAQVQFRLRQVVRGAPAE
QQRLLRELEDFAFRGCPHVLGYEGLEDPCDSEESDVLPGDRPRVRGEVQSEQEKRERLET
QREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDI
SSLSTEELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFISFIQDEVGSPLQTGGH
CECKTSGKAGISSTRAGSSTLPPGPDKAKAEDTKWVRETGLHLMRRALAVFQIFAVSQLG
CATGQIPQTLWQRGQADRDYSPLLKRLELSVDRVKQLALRHQPHDHVITSANLQDLSLGG
RDELTMAVRKELTVAVRDLLAHGLYASSSGMSLVMAPIACLLPAFSSAPETMHPWELFVK
YYHAKNGRAYVESPARKLSQSFALPIMGDAAVTPKQSLLTAIHLVLTEHDPFKRSADSEL
KALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLP
VDLAVRQLKNIKDAF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtggaagtggctacggagctgggaacagtagtgactgctgtcgggcctaag
gcgaaggacgaggaagaagaagaagacgaggaggagtcgctgccaccatgcgagactgtg
cgctgggctcctgtgggggcagttgccgaggccggtcctggggcggcgacgttctcggag
gaggcggcagccgaagagcctggagcggctccgggctctcctccggacgcgactgtccgc
acgctgaggcggttgcaagccgagcggcggcagctggattcggccctgctcgcgctgtcc
tcgcacttcgcgcaagttcagttccgcctgcgccaggtagtgcgcggggcgccggcggag
cagcaacgtctcctgcgcgagctcgaagactttgccttccgcggctgtcctcacgtccta
ggttatgaggggctggaagacccttgtgacagtgaagaaagcgatgtgctgccgggggac
cggccacgggtgcgcggcgaggtccagagtgaacaggaaaaacgggagcgcctggaaact
cagagggagaagcagaaggaattgattctgcaactcaagacccagcttgatgacctggaa
acctttgcttatcaggagggtagttatgactccttgccacagtccgtggtcttggaaaga
cagcgggtgatcatcgatgagttaataaagaaactggacatgaatctgaatgaggacatc
agttccctgtccaccgaggagcttcgacaacgtgtggatgcagcggtggctcagattgtc
aacccagctcgggtgaaagagcagttagtggaacagctgaaaacccagatccgggacctg
gagatgttcatcagcttcatccaagatgaagtgggaagccctctgcagacaggaggacac
tgtgagtgcaagaccagcgggaaggcaggaatcagttccaccagagcaggcagcagcaca
ctgcccccagggcctgacaaagcaaaggcagaagacacgaagtgggtccgggagacaggg
ctgcacctgatgcggcgagcgctggctgtgttccagatcttcgctgttagccagttgggc
tgtgccactggccagatccctcaaaccctgtggcagaggggccaggcagacagagactac
tccccattactgaaaagactggaactatcagtagacagagtaaagcaactagccctgaga
catcagccacatgaccatgtcatcacctcggccaacctccaggacctctctctgggaggc
agagatgagctgaccatggctgtgcggaaggagctgacagtggctgtgagggacctgctg
gcccatggactatatgcttcctcctctgggatgagccttgtcatggcccccattgcttgt
ttgttgccagctttctcctcagcccctgagaccatgcacccctgggagctctttgtaaag
tactatcatgccaagaatggccgtgcatatgtggaatccccagcccggaagctctcacag
tccttcgctctgcctataatgggtgatgctgctgtgacccccaaacagagccttctgaca
gccatccacctggtgctgacagagcatgaccctttcaagcgcagcgctgactcggaactg
aaggcattggtgtgcatggcactgaacgagcagcgcctggtgtcctgggtaaacctcatc
tgcaagtcggggtccctcatcgagccccattaccagccctggagctacatggcccacaca
ggttttgagagtgccctcaacctgctcagccgcctcagcagcctcaagttcagccttcct
gtcgacttggccgtgcgccagctcaaaaatatcaaagatgccttttga

DBGET integrated database retrieval system