KEGG   Rattus norvegicus (rat): 303554
Entry
303554            CDS       T01003                                 

Gene name
Nbr1, Ca125, RGD1311421
Definition
(RefSeq) NBR1, autophagy cargo receptor
  KO
K17987  next to BRCA1 gene 1 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    303554 (Nbr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303554 (Nbr1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    303554 (Nbr1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    303554 (Nbr1)
  Pexophagy
   Other pexophagy associated proteins
    303554 (Nbr1)
  Aggrephagy
   Cargo receptors
    303554 (Nbr1)
  Xenophagy
    303554 (Nbr1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    303554 (Nbr1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    303554 (Nbr1)
SSDB
Motif
Pfam: N_BRCA1_IG PB1 ZZ C1_2
Other DBs
NCBI-GeneID: 303554
NCBI-ProteinID: NP_001019936
RGD: 69195
Ensembl: ENSRNOG00000020730
UniProt: Q501R9
Position
10q31
AA seq 983 aa
MEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVKVSFDLNTIQIKYLDEENEEISINS
QGEYEEALKMANIKQGNQLQMQVHEGCHVVDEVLPQTVVEKQATARTGKKPLAHYSSLVR
VLGSDMKTTEEPTAEARSPVPCDTDKPQDKPPDWFTSYLEMFREQVVKETVEKLEQRLQE
KLVLQKPPFSSSPSEVSMPISEEETLFLPENQFSWHIACSHCQKRIVGVRYQCSLCPSYN
ICEDCEAGPYSHDTNHILLKFRRPVVISSEPFFYSKYPTPRLPAALEQVRLQKQVDKNFV
KAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLM
LPLQPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGN
LTLASTEKKDVLVPCLKAGHIGVVSVEFIAPTLEGTYTLHWRLSHKGQQFGPRVWCSIIV
DPFPSSESPVNLERDGISSSKADDFTCEQEEAFLLAEEEIPLGEVTKQTEGTGSSAPQKT
QHAASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPRMSPLPHDSPL
IEKPGLGRIQEESEGAGLKASPDSTVLTKRKAETPASVEETEEDLSGTQFVCETVIRSLT
LDAAPDHNPPCRQRSPQRELQLYSTEEQQPLMLPGFCRKDSSLKFALPEEGPHGDEREEI
VHIAEEEAIEEEDVQDEEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLER
GAEGEPGIESGQEPAEARERLPERESQPKEQSISDILTTSQHLDTVPLVPEVAGLPAALS
RSAPCGQYEAPRVDSPVTIQEVLPVPDHVRGEPRGSTGLANSRQKSCDHSRHHNGSSIAG
GLVKGALSVAASAYKALFSGPPVTAQPVISEDQTAALMAHLFEMGFCDRQLNLRLLRKHN
HNILQVVTELLQVNNNDWYSHRY
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggaaccacaggttactctaaatgtgacttttaaaaatgaaactcaaagctttctggtt
tcggatccagaaaatacaacttgggctgatgttgaagctatggtaaaagtttcatttgat
ctgaatactatccaaataaaatacctggatgaggaaaatgaggagatatccatcaatagt
caaggagaatatgaagaagcacttaagatggctaacattaagcaaggaaatcaactacag
atgcaagtccacgaagggtgccatgttgtagatgaagtgctcccccaaactgtagtagaa
aaacaagcaactgccaggacagggaagaagccactcgcacattactcttcgctggtaaga
gtcttgggatcagatatgaagaccacagaggagcctacagcagaggcacgttcacctgtt
ccttgtgacaccgacaagcctcaagacaagcccccagactggtttacaagctacctggag
atgttcagagaacaagtggtgaaggaaacggtggagaagcttgaacagaggttgcaggag
aagcttgtcctccagaagccacccttcagttcctcaccctcagaagtctcaatgcctatt
tcagaggaggaaaccctgtttttgccagagaaccagttcagctggcatattgcttgtagc
cactgccaaaagaggatcgtcggtgtgcgctaccagtgtagcctctgcccatcctacaac
atttgtgaagattgtgaagctggaccttactcccatgacactaaccacattttgctaaaa
tttcggagacctgttgtgatttcctctgagccatttttctactcaaagtatcccactcct
cgtctgcctgctgctttggaacaagtcaggctccaaaagcaggtggataagaattttgtg
aaagcagaaaagcaaaggttgcgggctgagaagaaacagcggaaggcagaggtcaaagag
cttaaaaagcagctgaaactccaccggaagattcatttgtggaattcaatccatggactc
cagagtcccaagtcgcctttgggtcgacctgagagcttgctgcagtctaacaccctcatg
cttcctttgcagccctgtgccccagttatgccaacactcagtgcagcattcgtggatgag
aatttgcctgatgggactcatcttcagccaggaaccaagtttatcaaacactggaggatg
aaaaacacagggaatgtgaagtggagcgcagacacaaagctcaagttcatgtggggaaac
ttgactctggcttctacagagaagaaggatgttttggttccctgcttgaaggctggacac
atcggggtggtgtctgtggagttcatcgccccaaccttggaggggacatacactttgcat
tggcgtctctctcacaaaggccagcagtttgggcctcgggtctggtgcagtatcatagtg
gatccttttccttcctctgagagccctgttaaccttgaaagggatgggattagctcaagc
aaagctgatgacttcacctgtgagcaagaggaagcttttcttctagctgaagaagagatt
ccattgggtgaggtgacaaagcagacagaagggacaggatccagtgccccacagaagaca
caacatgctgccagtgagagggagctctacattccatccgtggaccttctgactgcccag
gacctgctgtcctttgaactgctggatataaacattgttcaagaattggagagagtgcca
cacaacacccctgtggatgtgactccccgcatgtctcctctgccgcatgacagcccttta
atagagaagccaggcttggggcggatacaggaagagagtgaaggggcgggattgaaagca
tctcctgattccactgtattaacaaagagaaaggccgagacccctgcttcagtcgaagaa
acggaggaagacctgagtgggacccaatttgtgtgtgagactgtaatccgatccctaacc
ttggatgctgctccagaccacaaccctccttgcaggcagaggtccccacagagggaatta
cagctgtattccacagaagaacagcagcctcttatgctgcccggattctgcagaaaggat
tcttccttgaaatttgccttgcctgaagaaggaccacatggagatgagagggaggagatt
gtccacattgctgaggaagaagccattgaggaagaggatgtccaagatgaagaagttcag
agtcagtcttctgcttcctctgaagattatatcatcatcctgcctgagtgctttgatacc
agccgccccctgggggactccatgtacagctctgcgctctcccagccaggcctggagcga
ggggctgaaggtgaacctgggatcgagtctgggcaggaaccagctgaggctagagagaga
ctcccggaaagggagagccagccaaaggagcagagcatcagtgacatcctcacgacctca
cagcatctggacacagtgcctctagtcccagaagtggcaggacttccagcagcactgtcc
aggagcgccccttgtggacagtatgaggcaccacgagtggattcaccagttaccatccaa
gaagttctcccagtccccgatcacgtcagaggagagcccagaggctcaacaggactcgca
aacagccgacagaagagctgtgaccactcaaggcaccacaatgggagcagcattgctgga
ggactggtgaaaggggctttgtctgttgctgcctctgcgtacaaggccctgttttctggg
ccaccagtcactgcacagcccgtcatttctgaagatcagaccgcagccctgatggcccat
ctctttgaaatgggattctgcgacaggcagctgaacctaagactgctgagaaaacacaat
cacaatatcctgcaggttgtgacagagctcctccaagtgaacaacaacgactggtacagc
caccgctattga

DBGET integrated database retrieval system