KEGG   Rattus norvegicus (rat): 303575Help
Entry
303575            CDS       T01003                                 

Gene name
Kif18b, RGD1310360
Definition
(RefSeq) kinesin family member 18B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd SlyX
Motif
Other DBs
NCBI-GeneID: 303575
NCBI-ProteinID: NP_001034108
RGD: 1310360
Ensembl: ENSRNOG00000021713
UniProt: Q4KLL9
Position
10q32.1
AA seq 826 aa AA seqDB search
MVMAVEDSVVRVVVRVRPPTPKELESQRRPVIQVVDERMLVFDPEECDGGFPGLKWSGSL
SGPKKKGKDLTFVFDRVFSEVATQQDVFQHTTHNILDSFLQGYNCSVFAYGATGAGKTHT
MLGREGDPGIMYLTTMELYRRLEACQEEKQFEVLISYLEVYNEQIYDLLEPKGPLTIRED
PDKGVVVPGLSFHQPASAQQLLEMLTRGNCSRTQHPTDANATSSRSHAIFQIFVKQQDRV
PGLTQALRVAKMSLIDLAGSERASSTHAKGERLREGANINRSLLALINVLNALADAKGRK
SHVPYRDSKLTRLLKDSIGGNCRTVMIAAVSPSSLTYEDTYNTLKYADRAKEIRLTLKSN
VISLDHHISQYATICQQLQAEVAALREKLQTYEAGAQALQQRSPQPPKLSIPQNLSSSPL
QPGHSSQSCAPEFHAKYDAPQEESLGTDSQGQGTVEENAPEQEQPPQDKQFPTQMPEPNL
PGSPCPTVQAKQGMNQHSLQRLDAEHSKQLALRVLRLAQRQYSLLQAANLLTPDMISEFE
TLQQLVLEESMEHGAESPRSPGLARGIPLAQELCSESKSSRYCGPVTRTMAKQLSGLTHT
LGIPLAPDCTSDKTSQKPTKEKKRKLNLEEPGSLPAPSVEMKRQRQSFLPCLRRGSLPKI
QPSSEPRTPKGERASSPSPSSRVCPATVIKSRVPLGPSALQNCSTPLTLPTRDLNTTFNV
SEESPSKPSFPEPIDWEKVSPELNGTDQPFLPSAPVFIFTTKGRKPSLPTTTASKKRRTV
RPSVSRGRSCIARLPSSTLKKPDRPFTVPDPPLSLHCLDDHQVIRD
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggctgtggaagacagcgtggttcgggtggtcgtgcgggtgaggcctcccacc
cctaaggaactagagagtcagcgtcggcctgtgattcaggtggtagatgagcggatgctg
gtgtttgaccccgaggagtgtgatgggggatttcctggcctaaaatggagtggctccctc
agtggccccaagaagaagggcaaagacctgacatttgtctttgaccgggtcttcagtgag
gtggccactcaacaggatgtgttccagcacactacacacaacatccttgacagctttctc
cagggttacaactgctcagtgtttgcctatggagccactggggctgggaagacacacacc
atgctgggaagggagggagaccctggcatcatgtacctgaccaccatggaactgtaccgg
cgtcttgaagcctgccaggaagaaaagcagttcgaggtgctcatcagttacctggaggtg
tataacgagcagatctatgacctcctggagcccaaaggacccctcaccatccgagaggac
cctgataagggcgttgtggtaccgggactttctttccaccagccagcctcagcccaacag
ctactcgagatgctgaccagaggcaactgcagccgcacacagcaccccacagatgccaac
gccacatcttcccggtctcacgccattttccagatctttgtgaagcagcaggaccgggtt
ccaggactgacccaggcccttcgagtagccaagatgagcttgattgacctggctggctca
gagcgggcatctagcacccatgccaaaggagagcgtctgcgggagggtgccaacatcaac
cgctctctgttagcactcattaatgtcctcaatgccctggctgatgcaaagggccgcaag
tctcatgtaccctaccgagacagcaaactgacccgtctgctcaaggactccattgggggc
aactgccgcactgtgatgattgcagcggtcagcccttccagcctgacctatgaggatact
tacaacaccctcaaatacgctgaccgggccaaggagatcagactcacgctgaagagcaac
gtgatcagcctggaccatcacatcagtcagtatgccaccatctgccagcagctccaggct
gaggtggctgctctgagagagaagctccagacatatgaggctggagcccaggccctgcaa
cagcgttctccacagccccccaagttgagcataccgcaaaacctttctagctccccgtta
cagcctgggcactccagccagtcctgcgccccagagttccatgcaaagtatgacgctcct
caagaggagagcctgggaacagactctcagggacagggaactgtggaagaaaatgcccca
gagcaggagcagcctccccaggacaaacagtttccaacccagatgccagagccgaacctg
ccagggtctccttgtccaactgtgcaggcaaagcaaggcatgaaccaacactcactacag
agactggatgcagagcactctaaacagttggccctccgggtgctacgcctagcccagcga
cagtactccctgctgcaggcggccaatctcctgactcctgacatgatctcagagtttgag
accctgcagcagctggtgcttgaggagagcatggagcacggggctgagagccccaggtct
cctggtctggccagggggatcccgctagctcaggagctgtgttcagagtctaagtcttca
cggtactgtggtccagtgacccggaccatggcaaagcaactgagtggcctcacacacact
ctggggatcccactggcacctgactgcacctcagataagacgtcccaaaagcctaccaag
gagaagaaaaggaaactgaacctcgaagagccaggcagcctaccagcccccagtgtggag
atgaagcgccaacgccagtccttcctcccctgcctaaggaggggctccctgcctaagatc
cagccatcctctgagcccagaactcccaaaggagagagggcctcttctccctccccctcc
tcccgagtctgcccagccacagtcattaaaagccgggtacccctgggcccttctgcctta
cagaactgttccactcctctgaccctacccactcgtgacctcaataccacctttaatgtc
tctgaggaatccccctccaaacccagcttccccgaacctattgactgggagaaagtttcc
ccggagctgaacggcacagaccagccgttcctccccagtgcacctgtcttcatattcacc
acgaaaggccgcaagccttctcttcctacaaccactgccagcaagaagaggcgcactgtg
aggccctcagtctcccgaggccgcagctgcattgcccgcctccccagtagcaccttgaag
aagccagaccgacccttcacagtcccagatccacccttgagcctccactgccttgatgac
catcaagtcataagggactga

DBGET integrated database retrieval system