KEGG   Rattus norvegicus (rat): 303577Help
Entry
303577            CDS       T01003                                 

Gene name
Acbd4
Definition
(RefSeq) acyl-CoA binding domain containing 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ACBP
Motif
Other DBs
NCBI-GeneID: 303577
NCBI-ProteinID: NP_001012013
RGD: 1308404
Ensembl: ENSRNOG00000003108
UniProt: Q6DGF9
Position
10q32.1
AA seq 326 aa AA seqDB search
MGTEKEEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATAGPCLVPRPGFW
DPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQV
IPDMPRPPETFLRRVTGWQEPAVNRDVQAAPEPSHPPKEPAPPSPESRLPRDLDLEVFCD
SVEQLEPELVRVPVLSPVPAESELPHLHTGTGDSAQRVWAEQKEAAGRELTTRSSPESPE
GFGGSLMGPQELDRWLVGTVQAMQESMKDVHRRLQILESKPQPLEQQRSPRTRPWPLGLS
TPTLLFFILWPFVVQWLFRQFRTQRR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgagaaggaagagcccgactgtcaaaaacagttccaggcagcagtcagcgtc
attcagaacctgcctaagaatggctcttaccgcccctcctatgaagagatgctgcgattc
tacagctactacaagcaggctaccgcggggccctgcctggtcccccgacctgggttctgg
gaccccattggacgttacaagtgggatgcctggaacagcctggggaagatgagcagggag
gaagccatgtccgcctacatcacggagatgaagctggtggcacagaaggtgatcgacaca
gtgcccctgggcgaggtggcagaggatatgtttggttatttcgagcccctgtaccaggtg
atcccggacatgccgaggccgccagaaaccttcttgagaagggtcacaggttggcaagag
ccagcggtgaatagagacgttcaggctgctccagagccttctcatccccccaaggagcca
gcacctccaagtccagagtcccggctaccaagagacttggacctggaggttttctgtgac
tccgtggagcagctagagccagagttggtgagagtgcctgtcttgtcccctgttcctgct
gaatccgagttgccccacctccacactgggaccggggactctgctcagagggtttgggca
gagcagaaggaagccgctggcagagagctcaccaccaggagcagccccgagtcccccgag
gggtttggaggcagcctgatgggcccccaggagttggacagatggctggtggggacagtc
caggccatgcaggaaagcatgaaggacgttcacaggaggctacagatcctggagagcaag
ccccagccacttgagcagcagaggtcgcccaggactcggccttggcccctagggctctcg
actcccacgctgctcttctttatcctgtggcccttcgttgtccagtggctcttccgacag
tttcggacccagaggaggtga

DBGET integrated database retrieval system