KEGG   Rattus norvegicus (rat): 303584Help
Entry
303584            CDS       T01003                                 

Gene name
Plekhm1
Definition
(RefSeq) pleckstrin homology and RUN domain containing M1
  KO
K23282  pleckstrin homology domain-containing family M member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303584 (Plekhm1)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    303584 (Plekhm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_9 RUN PH DUF2072
Motif
Other DBs
NCBI-GeneID: 303584
NCBI-ProteinID: NP_001009677
RGD: 1308010
Ensembl: ENSRNOG00000028521
UniProt: Q5PQS0
Position
10q32.1
AA seq 1059 aa AA seqDB search
MLSVENGLDPRAAIQVIKKKLVGSVKALQKQHVSLDTVVTSEDGDANTMCSALEAVFIHG
LHAKYIRAEAGGKRKKHTHQKPLPQPVFWPLLKAVTHKHIISDLEHLVFINTDVGRCRAW
LRLALNDGLMECYLKLLLQEPARLCEYYQPTALLRDAEEAEFLLSFLQGLTSLSFELSYK
SAILNEWTLTPLSLSGLCPLSELDPLTVSGAELQRKESLDSISHSSGSEDIEVQHSGHKI
RRDRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGPKSPDHSEEPMSYDSDLGTANADD
SDRSLQEVLSEFSKAQVNSAPSSGPSQESDTPMFQTPLSLHSLANSTHLLFEGSEEPFPA
HTSSGTSSGHKHQPQESPDMQPLGTAQAGPAGSTSDQQPSSPVAGAADQGSEPWKALEYG
RVGPKLVVSSPTSPKGKSWISEDDFCRPPKEHALKNTSDLCISPLQGTPELRTALHGPFS
QGPRKSCSLGALDKACVSSLDYRNAQTAPSPAVTQDHKNFCVVHRRQMGLSNPFRGLMKL
GTVARRGAMGIWKEFFCELSPLELRLYLSDEERTCVESCSLLRCEAVGPAHSDGRFELVF
SGKKLALRASSQDEAEDWLDRVREALQKVRPQQEEEWVNIQYPDQAEDSPEAPPDNLPPY
SALLPEHAGAQGIQPNWTSAQVPEPDAIKESLLYLYADRTWIPYIFSLSLESLKCFRVRN
NEKMLSDSHGVETIRDILPDTSLGGPAFFKIITAKAVLKLQAKNTEEAAHWRDLVRKVLA
SYLESVQEAVTLAGSLDENCQEVLKFATRENGFLLQYLVAIPTEKGLDSQGCFCAGCSRQ
IGFSFVRPKLCAFSGLYYCDFCHQDDASVIPARIIHNWDLTKRPVCRQALKFLAQIRAQP
LINLQLVNASLYEHVERMHLIGRSREQLKLLGDYLGLCRSGALKELSKRLSHRNYLLESP
HKFSVADLQQIAEGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICHHQDIIFPFEFDT
TVRCAECRTVFHQSCQAVVRKGCPRCARRRKYQEQNTVS
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgctctcagtggagaatggcctggaccctcgggctgccatccaggtcatcaagaagaag
ctagtgggatctgtgaaggccctgcagaaacagcatgtgtctctggacacagtggtcacc
agtgaagatggagatgctaacaccatgtgcagtgccctggaggccgtgttcatccatggc
ttgcatgccaagtacatccgtgctgaggctggcggcaaaaggaagaagcacactcatcag
aagcctctgcctcagcctgtcttctggccccttctgaaagctgtcacccacaaacacatt
atctcagacttggagcacctggtcttcatcaatacagacgtaggccgctgccgggcctgg
ctgcggttggccctcaatgatgggctgatggagtgctacctgaagttgctcctgcaggaa
cctgcacggttgtgcgagtactatcagcccacggccctgcttcgagatgctgaggaagcc
gagttcctcctgagcttcctccaaggactaacatccttgtcttttgaactctcctacaag
tcagccatcttaaatgaatggacactcaccccactgtctctctctgggctttgccccctc
tctgaactggaccctctcactgtctctggtgcagaactgcaacggaaggagtctctggat
tccatttcccattcctcaggctctgaggacatcgaagtccaacactcaggccataagatc
cgcagggacaggaagctcaccgcctcttccctcagcctggacacagccagctcatcccag
ctatcctgcagcctaaattctgacagctgcctgctccaagagaatggtcccaagagtcca
gaccactctgaggaacccatgtcctacgactcagatctgggcacagcaaatgctgatgac
tctgacaggtctctgcaagaggtgttgtcggaattcagcaaagcccaggtaaattctgca
ccaagcagcggaccaagccaagagtcagacacccccatgttccagacccccctctccctc
cacagcctagctaacagcacacacctgctctttgaaggatctgaagagccctttcctgcc
catacatcctctgggacttcaagtggccacaagcatcagccccaggagagtccagacatg
cagccgctaggcactgcccaagctggccctgctgggagcacttcagaccagcagccatct
agtcccgtggccggagcagctgaccaaggaagtgagccttggaaggccctggaatatggc
agagttggaccgaagcttgtggtttcctctcctacgagtccgaaaggcaagagctggatt
tctgaagatgacttctgccgacctcccaaggagcatgctctgaagaacacttcagatctt
tgcatatctcctctgcaagggactccagagttgaggactgctctccacgggccgttttct
caaggaccaagaaagagctgctccctgggggccttagacaaagcgtgtgtgtcctcgctg
gactacagaaatgcccagacagctccatctccagcggtgacacaagaccataaaaacttc
tgtgtggtgcatcgaaggcagatggggctctctaacccattccggggcctcatgaagctg
ggcacagtagcccggcgaggagccatgggcatctggaaggaattcttttgtgagctgtcc
ccactggagctccgcctctacctgagtgacgaggagcgcacctgtgtggagagctgctcc
ctgctacggtgtgaggccgtgggaccagcacacagcgatggacgttttgagttggtcttc
tccggcaagaagctggctctccgtgcctcctcccaggacgaggctgaggactggcttgac
cgtgtgcgggaggctctgcagaaggtgcgccctcagcaggaggaggagtgggtgaatatc
cagtacccagaccaggctgaggattccccagaggcgccaccagacaaccttcccccctat
tcagccctgctcccagaacatgcaggtgcacagggaatacagccaaactggacatctgcc
caggttccagagccagatgctatcaaagagtctcttttgtacctgtatgcagaccggacc
tggattccctatatcttttccctgtccttggagtctctgaaatgtttccgtgtgagaaac
aatgagaagatgctaagtgatagccatggagtggagaccatccgggacatcctgccagac
accagccttgggggcccagccttcttcaaaatcatcacggccaaggctgtcctcaaactg
caggccaagaacactgaggaggccgcccactggagagacctagtcaggaaagtgctggcg
tcttacttagagtcagttcaggaggctgtgacacttgctgggagtctggatgaaaactgt
caggaggtcctgaagtttgccaccagggagaatggcttcctgctacagtaccttgtggcc
atcccgaccgagaagggcctcgactcccagggctgcttctgtgcaggttgctcccggcag
atcggcttctcctttgtacgacctaagctctgtgccttctctggcctatattactgtgac
ttctgccaccaagacgatgcctcggtgattccagccagaatcattcataactgggacctc
acaaagcgcccggtctgccggcaggccctgaagttcctggcccagatccgggcccagccc
ctcatcaacctgcagctggtgaacgcctctctgtatgagcatgtagagcgcatgcacctc
attggcaggagccgggagcagctgaaacttctgggggactacctgggcctgtgccgaagt
ggtgctctgaaggagttgagcaaaaggctaagccacaggaattacctcttggagtctcct
cacaaattcagtgttgctgacctccagcagattgcagagggggtgtatgaaggattcctc
aaagccctgattgaattcgcctcccagcatgtctaccactgtgacctgtgcacccagcga
ggcttcatctgccagatctgccaccaccaggacatcatctttccctttgagtttgacacc
acagtcaggtgtgctgaatgcagaactgtcttccatcagagctgccaggctgtggtgagg
aagggctgtccccgctgtgcccgccggcgcaagtaccaggaacagaacactgtcagttag

DBGET integrated database retrieval system