KEGG   Rattus norvegicus (rat): 303589
Entry
303589            CDS       T01003                                 

Gene name
Efcab3, RGD1305423
Definition
(RefSeq) EF-hand calcium binding domain 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 303589
NCBI-ProteinID: NP_001013994
RGD: 1305423
Ensembl: ENSRNOG00000042255
UniProt: Q66HC0
Position
10q32.1
AA seq 432 aa
MAISGFKGTLKLKPLKTPVFYKRDKDFRGYFSGHLQHKETKLSPAQLEAFRNAYNFFTKD
RTGCIDSHGLMSTVAKLGMNLNAYDIYNELKCADRDRDGKINFSDFIDVLTDKKLFLKAV
VPEKRICLDLANNPGILLFEILSKFVEISALHRKDIIELVSYFRKKFQESNSEILWSPYG
RRAFKTDICSPPRSSTAAFANSARISIMKERDLYKFLEALKRCNLRTDSPYSKIPVFPLF
PDVDGVVLGKPFKDTQKLEMLRKREPLSFFEDYFFNKRDWKTQAMNVKPLKSASGYSDDI
LAIDQLFKKKQHWTVSDAVALKQHVKRATDTYHLGIALDHRKEMLNLWKKIRGDLVGLES
NNESFYNTFSTYTWSWNVCQELLSAKDLRLHDANVNKTSPSNSGLSSPSDLSESDPETGR
KRKRKSSRGFRQ
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcaatctcgggatttaaaggcacgctgaagctgaaacccttaaaaacacctgtcttt
tacaagagagataaagattttcgagggtatttctcaggccatttacaacacaaagaaaca
aagctgagcccggcacaactggaagccttccgtaacgcttacaacttcttcaccaaggac
agaaccggctgtattgattcacacggattgatgagcactgtagcaaaactgggaatgaat
ctaaacgcatacgatatctacaatgaattaaaatgtgccgatcgtgacagggatggtaag
atcaacttctcagattttatagatgtgctgacagataagaaactcttcctcaaagctgtg
gttccagaaaagagaatatgcttagatttagctaacaatccagggatcttattgtttgaa
atcctatcaaagtttgtagagatttcagccctgcacagaaaggatataatagagttagta
agctatttccggaaaaagttccaggaaagcaactcagaaatactgtggagtccgtacggg
agaagggcctttaagacagacatatgctctcctcctcgctcaagcactgctgcctttgcc
aactctgccaggatctcaataatgaaagaacgggatttgtataagtttcttgaagcgctc
aaacggtgtaacctccgtacagatagcccatactcaaaaatacctgtgtttccattgttt
cctgacgtggatggggtggtgttgggaaagccattcaaagacacacagaaactagaaatg
ctaaggaaaagggagcctctgtctttttttgaggactattttttcaataaaagagattgg
aaaacacaggccatgaacgtgaaacctctcaagtctgcctcaggttattcagatgacatc
ttagccattgaccagctattcaagaagaagcaacattggactgtgtctgatgcagtcgct
ctcaaacagcatgtaaagagagccacagatacttatcacttaggaattgcccttgaccac
cggaaagaaatgctgaacctctggaagaagatccgaggggatctggttgggctggaaagc
aacaatgagtccttttacaataccttctctacctacacctggtcgtggaacgtgtgccag
gagctgctctccgctaaggacttgcggttgcacgacgctaacgtgaacaaaacctccccc
tccaactcggggttatcttccccatctgacctcagtgagtctgacccggagacgggaagg
aaaaggaaacggaaaagttccagaggctttcggcaatga

DBGET integrated database retrieval system