KEGG   Rattus norvegicus (rat): 303606
Entry
303606            CDS       T01003                                 

Gene name
Ccdc47, RGD1308813
Definition
(RefSeq) coiled-coil domain containing 47
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF1682
Other DBs
NCBI-GeneID: 303606
NCBI-ProteinID: NP_001013996
RGD: 1308813
Ensembl: ENSRNOG00000009006
UniProt: Q5U2X6
Position
10q32.1
AA seq 483 aa
MKAFCAFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVVEDSVTESPQRVINT
EDDEDEATVELEGQDEGQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSNKNKDPI
TIVDVPAHLQNSWESYYLEILMVTGLLAYIMNYIIGKNKNSRLAQAWFNSHRELLESNFT
LVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRP
VSDQVQIKVTMNDEDMDTYVFAVGTRKALLRLQKEMQDLSEFCSDKPKSGAKYGLPDSLA
ILSEMGEVTEGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLL
FTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKL
THVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKV
KAM
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaaagccttctgtgctttctgtgttgttctcttggtgtttgggagtgtctctgaagcc
aagtttgatgatttcgaggatgaggaagacatagtagagtatgatgataatgattttgct
gagtttgaggacgtcgtggaagattctgttacggaatctcctcagcgagtgatcaacact
gaagatgacgaggatgaggccaccgtggaattggaagggcaggatgaaggccaagaaggc
gatttcgaagatgcagatacccaggagggagatacagaaagtgagccatatgatgacgaa
gaatttgagggttatgaagacaaacctgatacctcttctaacaaaaataaagatccaata
acaattgttgatgttcctgcacacctccagaacagttgggagagttattacctagaaatt
ttgatggtgaccggtctgcttgcctatatcatgaactatatcatcgggaagaataaaaac
agccgacttgctcaggcctggtttaactctcatagagagcttttggagagcaattttacc
ttagtgggggatgatgggactaacaaagaagccacaagcacagggaagttgaaccaggag
aatgagcacatctataacctgtggtgttctggccgagtgtgctgtgaaggcatgctcatc
cagctgaggttcctgaagagacaagacttacttaacgtcctggcccggatgatgaggcca
gtgagtgatcaggtgcaaataaaagtcacaatgaacgacgaggacatggatacatacgtg
ttcgctgtcggcactcgcaaagctttgctgcgactgcagaaagagatgcaggatctgagt
gagttttgtagtgataaacctaagtctggagcgaagtatggactgccagactctttggcc
attctgtcagagatgggagaagtcacagaggggatgatggatacaaagatggttcacttt
cttacacactatgctgataagattgaatctgttcatttttcagaccagttctctggtcca
aagattatgcaagaggaagggcagcctttaaagctgcctgacaccaagaggacactactg
tttacatttaatgtgcctggctcaggtaacacgtacccaaaggatatggaggctttgcta
cccctgatgaacatggtgatttattctatcgataaagccaaaaagttccgcctcaacaga
gaaggcaaacaaaaagcagataagaaccgggcacgcgtggaagagaactttctgaagctg
acacatgtacagagacaggaggctgcacagtctcggcgtgaggagaagaaaagagctgag
aaggagcggatcatgaatgaggaggaccctgaaaagcagcgcaggctggaggaagcggct
ttgaggagagaacaaaagaagttggagaagaagcaaatgaaaatgaaacaaatcaaagtg
aaagccatgtaa

DBGET integrated database retrieval system