KEGG   Rattus norvegicus (rat): 303634
Entry
303634            CDS       T01003                                 

Gene name
Gna13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    303634 (Gna13)
   04072 Phospholipase D signaling pathway
    303634 (Gna13)
   04071 Sphingolipid signaling pathway
    303634 (Gna13)
   04022 cGMP-PKG signaling pathway
    303634 (Gna13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    303634 (Gna13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    303634 (Gna13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    303634 (Gna13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    303634 (Gna13)
  09156 Nervous system
   04730 Long-term depression
    303634 (Gna13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303634 (Gna13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    303634 (Gna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    303634 (Gna13)
   04031 GTP-binding proteins [BR:rno04031]
    303634 (Gna13)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   303634 (Gna13)
  Exosomal proteins of colorectal cancer cells
   303634 (Gna13)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    303634 (Gna13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 303634
NCBI-ProteinID: NP_001013137
RGD: 1310221
Ensembl: ENSRNOG00000036745
UniProt: Q6Q7Y5
Position
10
AA seq 377 aa
MADFLPSRSVLSVCFPGCVLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQVHGD
KLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWDDSGIQNAYDRRREFQLGESVKYFLDN
LDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDQQQRPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcgctccgtgctgtccgtgtgcttcccgggctgcgtgctg
acgaacggcgaggccgagcagcagcgcaagtccaaggagatcgacaaatgcctgtcgcgg
gagaagacctacgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacggccaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggta
gatgcccgagagaagcttcatattccctggggagataacaaaaaccaggtccacggagac
aagttgatggcatttgatacccgagctcccatggctgcccaggggatggtggagactcga
gtttttttgcagtatcttcctgctataagagccttatgggatgacagtggcatacagaat
gcctacgatcggcgccgggaattccaactgggtgagtctgtaaagtatttcctggataac
ttggataaacttggagtaccggactacattccgtcacagcaagatattctgcttgccaga
agacccaccaaaggcatccatgagtatgactttgaaattaaaaatgttcctttcaaaatg
gttgacgtaggtggccagagatcagaacggaaacgttggtttgaatgctttgacagtgtg
acatcaatactcttccttgtttcttcaagtgagtttgaccaggtgcttatggaggaccgc
ctgaccaaccgcctcacagagtccctgaacatttttgaaacaattgtcaataaccgggtt
ttcagcaatgtctctataattctcttcttaaacaagacagacttgcttgaggagaaagtg
caagttgtaagcatcaaagactatttcctagaatttgaaggggaccctcactgcttaaga
gacgtccaaaagtttctggtggaatgcttccgggggaaacgccgggaccagcagcagagg
ccgctgtaccaccacttcaccaccgccatcaacacagagaacatccgccttgtgttccga
gacgtgaaggacacgatccttcatgacaacctcaagcagcttatgctccagtga

KEGG   Rattus norvegicus (rat): 81663
Entry
81663             CDS       T01003                                 

Gene name
Gna12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04270  Vascular smooth muscle contraction
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05163  Human cytomegalovirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81663 (Gna12)
   04072 Phospholipase D signaling pathway
    81663 (Gna12)
   04071 Sphingolipid signaling pathway
    81663 (Gna12)
   04022 cGMP-PKG signaling pathway
    81663 (Gna12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81663 (Gna12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    81663 (Gna12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81663 (Gna12)
  09156 Nervous system
   04730 Long-term depression
    81663 (Gna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81663 (Gna12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    81663 (Gna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81663 (Gna12)
   04031 GTP-binding proteins [BR:rno04031]
    81663 (Gna12)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   81663 (Gna12)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    81663 (Gna12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 81663
NCBI-ProteinID: NP_112296
RGD: 71018
Ensembl: ENSRNOG00000001235
Vega: OTTRNOG00000002220
UniProt: Q63210 Q45QM2
Position
12
AA seq 379 aa
MSGVVRTLSRCLLPAEAGARERRAGAARDAEREARRRSRDIDALLARERRAVRRLVKILL
LGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHS
ENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYF
LDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCF
DGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLV
EKVKSVSIKKHFPDFKGDPHRLEDVQRYLVQCFDRKRRNRGKPLFHHFTTAIDTENIRFV
FHAVKDTILQENLKDIMLQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcttgctgccggccgaggccggagcccgc
gagcgcagggcgggcgcggcgcgcgacgcggaacgcgaggcccgacggcgcagccgcgac
atcgacgcgctgctggcccgcgagcggcgcgcggtgcggcggctggtcaagatcttgctg
ctgggcgccggcgagagcggcaagtccaccttcctcaagcagatgcgcatcatccacggc
cgggagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaacatcctt
aagggctcgagggtgcttgtagacgctcgggacaagcttggcattccctggcagcactct
gagaacgagaagcacgggatgtttctgatggccttcgagaacaaggcagggctgcctgtg
gagcctgccaccttccagctctacgttccagccctgagcgcactctggagagactccggg
atcagggaagccttcagccgcagaagcgagttccagctgggtgagtcagtgaagtacttc
ctggataacttagaccggattggccagctgaactacttccccagtaagcaagacatcctg
ttggctagaaaggccaccaagggaatcgtggagcatgacttcgtgataaagaaaatccca
tttaagatggtggatgtgggcggccagaggtcgcagcgccagaagtggttccagtgcttc
gacgggatcacatcgatcctgttcatggtgtcctcaagcgagtatgaccaggtcctcatg
gaggataggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatcgtcaac
aacaagctcttcttcaacgtctccatcatcctcttcctcaacaagatggacctgctggtg
gagaaggtgaagtcggtgagcattaagaagcacttcccagacttcaagggcgacccgcac
cggctggaggacgtccagcgctacctggtccagtgctttgacaggaagcgcaggaaccgc
ggcaagcctctgttccaccacttcaccactgccatagacaccgagaacatccgcttcgtg
tttcatgccgtgaaggacaccatcctgcaggagaacctgaaagatatcatgctgcagtga

DBGET integrated database retrieval system