KEGG   Rattus norvegicus (rat): 303660Help
Entry
303660            CDS       T01003                                 

Gene name
Btbd17, RGD1563331
Definition
(RefSeq) BTB domain containing 17
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BACK BTB
Motif
Other DBs
NCBI-GeneID: 303660
NCBI-ProteinID: NP_001128006
RGD: 1563331
Ensembl: ENSRNOG00000003109
UniProt: D4A8L9
Position
10q32.1
AA seq 507 aa AA seqDB search
MIRKGSCKPGSWGSFWAILALVGLATRAEPPVRPFVSLVGSTRLGAFSGSAMSLPAAAQR
ADVVGEAAGISINHSHMLLQRLQDLLRHGNASDVVLRVQAVGTDEVRAFHTHRLLLGLHS
ELFRELLSNQSEVVLQEPGDCAAVFDKFIRYLYCGELTVLLAQAIPLHRLATKYRVASLQ
RGVADYMRAHLAGGAGPAVGWYHYAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSPE
LLAQLLQRSDLVLQDELELFHALEAWLGRTRPPPTVAERALRAIRYPMIPPAQLFQLQAR
SAALARHGPAVADLLLQAYQFHAASPLHYAKFFHVNSSAFLPRNYLAPAWGAPWVINNPA
RDDRSTSFQTQLGPSGHDAGRRITWNVLFSPRWLPVSLRPVYADAAGTALPAARPEDGRP
RLVVTPASSGGDAAGVSFQKTVLVGARHQGRLLVRHAYSFHQSSEEAGDFLAHADLQRRN
SEYLVENALHLHLIVKPVYHTLIRTPS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaaggctcctgcaagcccgggtcctggggcagcttctgggctatcctggcc
ttggtgggactggccactcgtgcagagccaccagttcgtccctttgtatccttagttgga
agcaccaggctgggtgccttctcaggctctgccatgtcccttcctgctgcagctcagaga
gccgatgtggttggggaggcagcaggcatctccatcaaccactcccacatgctgctccag
cgactgcaggacctgctgcgccacggcaacgccagtgatgtcgtcctccgagtacaagct
gtgggcacggacgaggtccgagccttccacacccatcgcttgttgctggggctacacagt
gagctgttccgggagctgctgagcaaccagagtgaggtggtgctgcaggaaccgggggac
tgtgctgccgtctttgacaagttcatcaggtatttgtactgtggtgagctgacggtacta
ctggcccaggctatcccactgcataggctggccaccaaataccgagtagcatccttgcag
cgaggcgtggccgactacatgcgcgcgcacctggcgggaggcgcgggccccgctgtgggc
tggtaccactatgcagtgagcaccggggatgaggctctgcgcgagagctgcctgcagttc
ctggcttggaacctttctgccgtggcggggagcgcggagtggggcgccgtgagccccgag
ttgctggcacagctcttgcagcgctcggacctggtgctgcaggatgagctggagctgttc
cacgcgctggaggcgtggctgggccgaacgcggccgccccccaccgtggccgagcgagcg
ctgcgcgccatccgctaccccatgatcccgccggcacagctgttccagctgcaggcgcgc
tcggccgcgctggcgcgccacggcccggcggtggcagatctcttgctgcaggcttatcag
ttccacgccgcctcgccgttgcactacgccaagttcttccacgtgaacagcagtgctttc
ctgccgcgcaactacctcgccccggcctggggcgccccatgggtcatcaacaacccggct
cgcgacgatcgcagcaccagcttccagacgcagctggggccaagcggccacgacgcgggt
cgtcggattacctggaacgtgctcttctccccgcgctggctacccgtcagcctgcggccc
gtctacgcggacgccgcgggtaccgcgctgcccgccgcgcgcccggaagatgggaggccg
cgactggtggtcacgccggctagcagcggtggggacgcggcgggcgtgagtttccagaag
accgtgctggtgggtgcgcgccatcagggccgcctcttggtccgccacgcctacagcttc
catcagagcagcgaggaggctggcgacttcctggcccacgcagatctgcagaggcgcaac
tccgaatacctggtggagaatgcactgcatctccatctcattgtcaagccggtgtaccac
accctcatccggactcccagttag

DBGET integrated database retrieval system