KEGG   Rattus norvegicus (rat): 303702
Entry
303702            CDS       T01003                                 

Gene name
Engase
Definition
(RefSeq) cytosolic endo-beta-N-acetylglucosaminidase
  KO
K01227  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [EC:3.2.1.96]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    303702 (Engase)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.96  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
     303702 (Engase)
SSDB
Motif
Pfam: Glyco_hydro_85
Other DBs
NCBI-GeneID: 303702
NCBI-ProteinID: NP_001100540
RGD: 1310868
Ensembl: ENSRNOG00000027498
UniProt: D4AE03
Position
10
AA seq 732 aa
METSSVLTRGASRQRGSTAPEKQAQDQPERRRRRQGRRINKDQEEEAVFRDVVNFAPDPL
PARYYDKDTTRPISFYLSTLEELLAWTPLMEDGFNVALEPLECRQPPLSSPRPRTLLCHD
MMGGYLEDRFIQGSEVQNPYSFYHWQYIDIFVYFSHHTVTIPPVCWTNAAHRHGVCVLGT
FITEWQEGGKLCEAFLAGDERSFQAVADRLVQIAQFFRFDGWLINIENSLSPAAVRNTPL
FLQYLTRQLHQQVPGGLVLWYDSVVQSGQLKWQDELNEQNRVFFDSCDGFFTNYNWREDH
LKRMVAQAGERLADVYVGIDVFARSNVVGGRFDTDKSLELIRKHGFSAALFAPGWVYECL
EKNDFFQNQDKFWRLLERFLPTHSICSLPFVTSFCLGLGTRRVCYGKEQAVGPWYHPSAQ
ETQPLFGEHKLAGGNRGWVKTHCCLVDAWHGGSSLLLRGLIPPEVDSVAVRLFSMHVPVP
PKVFLSMVYKFEGSTDVQVALELTTGDASSCHVGGVLVLNETGTRYSPRPLRVPPTRLAR
WASSCGQQLSGGWIQRCYEVNLRGCLLQDLLVSFSRPPGSREEESFICRLGEIQVVDANS
LLAPLPRVQNVTISQLRWLPLISGSEGLPTRLLLSCTLHWSYLLPRARCFRIHCWERTGS
SSATEESPGTEKPEFLGLAFANQYRVVDLAVEAARFGQDGRVEFLVEPVPREGFLVPQAE
WGRAVLLYSAPQ
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggagacctcgtcggtgctcacccggggggcttcacggcagcggggctccacggccccg
gagaagcaggcgcaggaccagccagagcggaggcggaggaggcaggggcggaggatcaac
aaggatcaagaggaggaagctgtcttcagagatgtggtcaattttgctccggatccttta
ccagctagatattatgacaaggatactaccagacctatcagcttttacctatcaacgctg
gaggagctcctggcctggacccccctcatggaagatggcttcaatgtagccctggaaccc
ctggagtgtcgccagcccccactgagcagccccaggccccggaccctgctgtgccatgac
atgatgggcgggtacctggaggacaggttcatccagggctcagaggtgcagaatccttac
tccttctaccactggcagtacatcgacatctttgtgtacttcagccatcacacggtcacc
atcccaccagtgtgctggaccaacgccgcccacaggcacggggtgtgtgtgctggggacc
tttatcacagagtggcaagagggaggcaaactctgtgaagccttcctggccggggatgag
cgctccttccaggcagtggccgatcggctggtccagattgctcagtttttccgttttgac
ggctggctcatcaacattgagaactccctgagcccagctgccgtgaggaacacacctctg
tttctccagtacctgaccagacagctccatcagcaggtccccggaggtctggtgctgtgg
tatgacagtgtggtacagagcggacagctcaagtggcaggatgaactgaacgaacagaac
agggtcttcttcgactcctgtgatggcttctttaccaactataactggcgggaggaccac
ctgaagaggatggtggcgcaggccggggagcgcctggctgacgtgtacgtgggcatagat
gtgtttgctcggagcaatgtggtcggaggccgttttgatactgacaagtcactggagctg
atccgtaagcatggcttctcagcggccctgtttgctccggggtgggtgtatgagtgtctg
gagaagaacgacttctttcagaaccaggacaagttctggagactgctggagcgcttcctg
cccacacacagtatctgttccctcccctttgtcacttctttctgcctgggcctgggtact
cgaagagtctgctatggcaaggagcaggcagtggggccctggtaccaccctagtgcccag
gagacacagcccctctttggtgaacataagctggctggtggcaatcggggctgggtgaag
acacactgctgcctggttgacgcctggcacgggggcagctctctgctgctccggggcctg
atcccgcctgaggttgacagtgtagctgtgaggctgttctctatgcacgtcccagtgcct
cccaaggttttcctgtccatggtgtacaagtttgaaggctcaacggatgtccaggtggct
ttggagctcacgacaggggatgccagcagctgccatgtgggcggtgtgttggtgttaaat
gaaactggcacacggtacagccccagacccctccgggtacccccaaccaggttggccaga
tgggccagcagttgtggccagcagctcagtgggggctggattcaacgctgctatgaggta
aaccttcgtgggtgcctgctccaggacctcttggtgagcttctcacggccaccaggcagc
cgggaggaggagagcttcatctgtcgtcttggagagatccaggtggttgatgccaacagc
cttctggcccctttgccccgggtgcagaatgtcaccatttcacagctacgctggcttcct
ctgatctctgggtctgagggcctccctacccggctcctcctcagctgtaccctgcactgg
tcctacctgctgccccgagcccgctgcttccggattcactgctgggaacggacaggaagc
agctctgcaacagaggaatccccagggacagagaagcccgagttcctgggcctggctttt
gccaaccagtaccgcgtggtggacttggcagtggaggctgctagatttgggcaggacggt
cgtgtggagttcctggtggagcctgtccccagggagggtttcctagtgcctcaggctgag
tggggaagggcagtactgctctactcggcccctcagtga

DBGET integrated database retrieval system