KEGG   Rattus norvegicus (rat): 303731Help
Entry
303731            CDS       T01003                                 

Gene name
Cbx8
Definition
(RefSeq) chromobox 8
  KO
K11455  chromobox protein 8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    303731 (Cbx8)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     303731 (Cbx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo CBX7_C RBR Mtf2_C Tudor-knot VirC1
Motif
Other DBs
NCBI-GeneID: 303731
NCBI-ProteinID: NP_001029250
RGD: 1565375
Ensembl: ENSRNOG00000048113
UniProt: Q4FZS1
Position
10q32.3
AA seq 366 aa AA seqDB search
MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSTRGIRIPYPGRSPQDLASTSRA
REGLRNTGLPPPGSSTSTCRADPPRDRDRDRDRERDRGTSRVDEKPSSPGDSSKKRGPKP
RKELLDPSQRPLGEPSDGLGEYLKGRKLDETPSGIGKFSAGHSVIQLARRQDSDLVQYGV
TSPSSAEASGKLAADTFPARVIKHRAALLEAKGQGALDPGGTRVRHSSGTPGSVGSLYRD
MGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQG
FFKEKR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcggcggtgggggagcgggtgttcgcggccgaagccctcctgaagcggcgc
attcgcaaaggacgcatggaatatctcgtgaaatggaagggctggtcgcagaagtacagc
acgtgggagcctgaagaaaatattcttgatgctcgcctccttgcagcctttgaagaaagg
gaacgggagatggagctctatggtcccaaaaagcgaggacccaagcctaaaaccttcctt
ctcaaggcccaggccaaggcaaaggccaaaacctatgaattcagaagcgactctaccaga
ggcatccggatcccttacccaggccgctctccccaggatttggcatctacttctagggcc
cgagagggccttcggaacacggggctacccccaccagggagcagtaccagtacctgcagg
gcagacccacctcgggacagagaccgagaccgggatcgagaacgggacaggggtaccagc
cgtgtagatgagaagcccagctcaccgggggacagctccaagaaacgaggacccaagccc
aggaaggagctcctagacccttcacagagacctttgggagagcccagtgatggccttgga
gaatacctcaaaggcaggaagctggatgagaccccctctgggataggaaagttctcagct
ggccacagcgtgatccagcttgctcggaggcaggactcagacctggtacaatacggtgtg
accagtcctagctcggcggaggcctcgggcaagttggctgcggacacctttccagccagg
gtgataaagcaccgggctgctttactggaggccaaaggtcaaggtgccctggaccctggt
gggaccagggtccgacatagttcaggcaccccgggctcagtgggaagcctgtatcgggac
atgggggctcaagggggaaggccctccctcatcgccaggatcccagtggccagaatcctg
ggggacccggaggaagagtcctggagcccctctctgactaacctggagaaggtggtcgtc
acagacgtgacctcaaactttttgaccgtcaccattaaggagagtaacacggaccaaggc
ttctttaaggagaaaagatga

DBGET integrated database retrieval system