KEGG   Rattus norvegicus (rat): 303741
Entry
303741            CDS       T01003                                 

Gene name
Fscn2
Definition
(RefSeq) fascin actin-bundling protein 2, retinal
  KO
K17455  fascin2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    303741 (Fscn2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     303741 (Fscn2)
SSDB
Motif
Pfam: Fascin FRG1 FGF DUF569
Other DBs
NCBI-GeneID: 303741
NCBI-ProteinID: NP_001100542
RGD: 1308941
Ensembl: ENSRNOG00000036700
UniProt: D3ZX02
Position
10q32.3
AA seq 492 aa
MPTNGLHQVLKIQFGLVNDADRYLTAESFGFKVNASAASLKRKQIWVLEPDPGQGTAVLF
RSSHLGRYLSAEEDGRVACEMDHPGRDCRFLVLPQPDGRWVLQSEPHGRFFGGVEDRLSC
FATAISPAELWTVHLAIHPQAHLLSVSRRRYVHLCLQEDEMAADGDMPWGVDALLTLIFQ
SRRYCLKSYDSRYLRSDGRLVWEPEAHACYTLEFKAGKLAFKDCDGRYLAPVGPAGTLKA
GRNTRPGKDELFDLEQSHPQVVLVAANHRYVSVRQGINVSANQDEELDHETFLMQIDQET
KKCTFYSSTGGYWTLVTHGGIQATATQVSANTMFEIEWHGRRVALKASNGRYVCMKKNGQ
LAAISDFVGEDELFILKLINRPILVLRGLDGFVCHRRGSNQLDTNRSTYDVFHLSFRDGA
YQIRGRGGGFWYTGSHGSVCSDGDLAEDFLFEFRERGRLAIRALSGKYLRGGASGLLRAD
ADLPTGEALWEY
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgccaaccaacggcttgcaccaggtgctgaagatccagtttggccttgtgaacgatgcc
gaccgctacctcacggctgagagctttggcttcaaggtcaacgcttccgcagccagcctc
aagaggaagcagatatgggtcctggagcctgacccagggcagggcactgctgtgctgttt
cgcagcagccacctaggccgctacctgtcggcagaagaagatgggcgcgtggcctgtgag
atggatcacccgggccgtgactgtcgcttcttggtcttgccgcagcctgacgggcgctgg
gtgctgcagtcagagccacacggccgcttctttggtggcgttgaggaccgactgtcctgc
tttgctacggccatctccccggcagagctgtggaccgtacacctggccatccacccacag
gctcacttgctgagtgtgagccgccggcgctacgtgcacctgtgccttcaggaggacgag
atggcggcagatggtgacatgccgtggggtgtggacgcactgctcaccctcattttccag
agcaggcggtactgcctcaagtcttatgacagccgctaccttcgaagtgatggccgcctt
gtctgggagcctgaagcccatgcctgctacacactggagttcaaggcaggcaagctggcc
ttcaaggactgtgacggccgatacctggcacctgtggggcctgccggcacgcttaaggct
ggccgaaacacgaggcccggcaaggatgaactcttcgacctggagcagagtcacccacag
gtggtactggtagctgccaaccaccgctacgtctctgtgaggcaaggaatcaatgtctca
gccaatcaggatgaagaactggaccatgagacattcctaatgcaaatcgaccaggagaca
aagaagtgtactttctattccagcactgggggctactggaccttggtcactcacgggggc
attcaggccacagccacgcaagtttctgccaacaccatgtttgaaatagaatggcacggc
cggcgggtggcacttaaagccagcaatgggcgttatgtgtgcatgaagaagaatgggcag
ctggctgctatcagtgactttgtgggtgaggacgagttattcatcctcaaactcatcaac
cgacccatcctggtgctccgtggcctggatggctttgtgtgccaccgccgaggctccaac
cagctggacaccaaccgctccacctacgatgtcttccacctgagcttcagggatggcgcc
tatcaaatcagaggccgtggaggtgggttctggtacactgggagccatggaagtgtgtgc
agcgatggtgacttggcggaggatttcctcttcgagttccgagagcgtggccgtttggcc
atccgtgccctcagtggcaagtacctgcgtggaggtgcctcagggctgctgcgtgctgac
gcggacctgcctacgggggaagctctctgggaatattga

DBGET integrated database retrieval system