KEGG   Rattus norvegicus (rat): 303743Help
Entry
303743            CDS       T01003                                 

Gene name
Notum, RGD1307119
Definition
(RefSeq) NOTUM, palmitoleoyl-protein carboxylesterase
  KO
K19882  O-palmitoleoyl-L-serine hydrolase [EC:3.1.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303743 (Notum)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.98  [Wnt protein] O-palmitoleoyl-L-serine hydrolase
     303743 (Notum)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAE Gp37
Motif
Other DBs
NCBI-GeneID: 303743
NCBI-ProteinID: NP_001013997
RGD: 1307119
Ensembl: ENSRNOG00000036680
UniProt: D3ZXI3
Position
10q32.3
AA seq 503 aa AA seqDB search
MGGEVRVLLLLGLLHWVGGSEGRKTWRRRGQQPPQPPPPPPPPQRAEVAPGAGQPVESFP
LDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKE
SKGSRRWLLFLEGGWYCFNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWW
NANMVFIPYCSSDVWSGASPKSEKNEYAFMGSLIIQEVVRELLVKGLSGAKVLLLAGSSA
GGTGVLLNVDRVAELLEELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTEAIRR
GIRYWSGMVPERCQRQFKEGEEWNCFFGYKIYPTLRCPVFVVQWLFDEAQLTVDNVHLTG
QPVQEGQWLYIQNLGRELRGTLKDVQASFAPACLSHEIIIRSYWTDVQVKGTSLPRALHC
WDRSFHDSHKASKTPMKGCPFHLVDSCPWPHCNPSCPTIRDQFTGQEMNVAQFLMHMGFD
VQTVAQQQGMEPSKLLGILSSGN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggcggagaggtgcgcgtgctgctactgctgggcctgctgcactgggttgggggcagc
gagggcaggaagacctggaggcgccgtggccagcagccaccccagccgccgcccccgccg
ccgcccccgcagcgggctgaggtggcgccgggagccgggcagccggtggagagcttcccg
ctggacttcacggcagtggagggcaacatggacagctttatggcgcaagtcaagagcctg
gcacagtccctgtatccctgctctgcgcagcagctcaacgaggacctgcgccttcacctc
ctgctgaacacgtcggtgacctgcaatgacggcagccccgccggctactatttgaaggag
tccaagggcagtcggcggtggttactctttctggaaggcggctggtattgcttcaaccgg
gagaactgtgactccagatacagcaccatgcggcgcctcatgagctccaaagactggcca
cacacgcgcacaggtactggtattctatcctcccagccagaggagaacccacactggtgg
aatgccaatatggtcttcatcccctactgctccagtgacgtttggagtggggcttcaccc
aagtctgagaagaatgagtatgccttcatgggctccctcatcatccaggaagtggtacgg
gagctcctggtcaaagggctgagtggggcaaaggtgttgctgctggctgggagcagtgct
gggggcaccggggtgctgttgaatgtagaccgcgtggctgagctgttggaggagttgggc
tacccatctatccaggtgcggggcctggctgactcaggttggttcctggacaacaagcag
taccgacggtcagactgcatcgataccatcaactgtgcacccacggaggccatccgccga
ggcatcaggtactggagtggaatggtcccagagcgctgccagcgccagttcaaggaagga
gaggaatggaattgcttctttggctacaaaatatatcccactctgcgctgtccagtgttc
gtagttcagtggcttttcgatgaggctcagctgaccgtggataacgtgcatctcactggg
cagccggttcaggagggccagtggctgtacatccagaatctgggccgagaactgcgtggc
acactcaaggatgtgcaggccagctttgcccccgcctgcctgtcccatgagatcatcata
cggagctattggacagatgtccaggtgaaggggacctcactgccccgggcactgcactgc
tgggaccggagcttccatgacagccataaggccagcaaaacgcccatgaagggctgccct
ttccacctggtagacagctgtccctggccccactgcaatccctcatgccctaccatccgg
gaccagttcacaggccaagagatgaacgtggcacagttccttatgcacatgggcttcgat
gtgcagacggtggcccaacagcaggggatggagcccagcaaactgctagggatactgagt
agcggaaactag

DBGET integrated database retrieval system