KEGG   Rattus norvegicus (rat): 303745
Entry
303745            CDS       T01003                                 

Gene name
Sirt7
Definition
(RefSeq) sirtuin 7
  KO
K11417  NAD+-dependent protein deacetylase sirtuin 7 [EC:2.3.1.286]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    303745 (Sirt7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    303745 (Sirt7)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     303745 (Sirt7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     303745 (Sirt7)
SSDB
Motif
Pfam: SIR2 DUF563
Other DBs
NCBI-GeneID: 303745
NCBI-ProteinID: NP_001100543
RGD: 1305876
Ensembl: ENSRNOG00000036683
UniProt: B2RZ55
Position
10q32.3
AA seq 402 aa
MAAGGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESEDLVT
ELQGRSRRREGLKRRQEEVCDDPEELRRKVRELAGAVRSARHLVVYTGAGISTAASIPDY
RGPNGVWTLLQKGRPVSAADLSEAEPTLTHMSITQLHKHKLVQHVVSQNCDGLHLRSGLP
RTAISELHGNMYIEVCTSCIPNREYVRVFDVTERTALHRHLTGRTCHKCGTQLRDTIVHF
GERGTLGQPLNWEAATEAASKADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQ
WTPKDDWAALKLHGKCDDVMRLLMDELGLEIPVYNRWQDPIFSLATPLRAGEEGSHSRKS
LCRSREEPPPGDQSAPLASATPILGGWFGRGCAKRAKRKKAA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcagccggtggcggtctgagccgctcggagcgcaaagcggctgagcgggtccggagg
ttgcgggaggagcagcagcgggagcgcctccgtcaggtgtcacgcatcctgaggaaggcg
gctgcagagcgcagcgcggaggagggccggcttctagctgagagtgaggatctggtgacc
gagcttcagggtcggagccggcggcgtgagggcctcaagcgccgccaggaggaggtgtgt
gatgacccagaggagttgcggaggaaggtccgcgaactagccggagctgtccgaagtgcc
agacacttggttgtctacacaggcgctgggatcagcacggcagcctctatcccagattac
cggggtcctaatggagtgtggacactgctccagaaaggaaggcctgtgagtgctgccgac
ctaagcgaagcagagcctaccctcacccacatgagcatcacccagctgcacaagcataag
ctggtgcaacacgtggtgtctcagaactgcgacgggctccacctgcgcagtgggctgcca
cggaccgccatctctgagctccatgggaatatgtatattgaagtctgcacctcctgcatc
cctaacagagagtacgtccgagtgtttgacgtgacggagcgtaccgcccttcaccgacac
ctgacaggccggacgtgccacaagtgtgggactcagcttcgggacaccattgtgcacttt
ggggagagggggacgctagggcagcccctgaactgggaggcagcgactgaggccgctagc
aaagcagacacaatcctgtgtttagggtccagcttgaaggtactgaagaagtacccccgt
ctctggtgcatgacgaagcccccaagccgtcggcccaaactctacattgtgaacctgcag
tggaccccgaaggatgactgggctgccctgaagcttcatgggaaatgtgatgatgtaatg
cggctcctcatggacgaactgggcctggagatccctgtctacaaccggtggcaggaccca
atcttctccttggcaactccactccgtgctggcgaagaaggtagccacagtaggaagtca
ctgtgcaggagcagagaagagcccccacccggggaccagagtgcccctcttgcctcagcc
acccccatcctaggaggctggttcggcaggggctgtgctaagcgtgcaaaaaggaagaaa
gcggcgtag

DBGET integrated database retrieval system