KEGG   Rattus norvegicus (rat): 303749Help
Entry
303749            CDS       T01003                                 

Gene name
Ogfod3, RGD1305007
Definition
(RefSeq) 2-oxoglutarate and iron-dependent oxygenase domain containing 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy_3 Oxygenase-NA
Motif
Other DBs
NCBI-GeneID: 303749
NCBI-ProteinID: NP_001013998
RGD: 1305007
Ensembl: ENSRNOG00000036668
UniProt: Q5M843
Position
10q32.3
AA seq 315 aa AA seqDB search
MAPQRRGPPRVPEGNSAAERRHANSTKKDRLPQEAQRTWLRIVALGVSLALVTFLLWSSA
GIDDDVAEVVAHRGEVLEGRFIEVPCSEDYDGHRRFEGCTPRKCGRGVTDIVITREEAEQ
IRRIAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQTIFSEEDFQLYRDI
RQKVQLTIAEAFGIRASLLYLTKPTFFSRINSTEAQTAHDEYWHAHVDKVTYGSFDYTSL
LYLSDYLEDFGGGRFVFMEEGSNKTVEPRAGRVSFFTSGSENLHRVEKVLWGTRYAITIA
FTCNPDHGIEDPVLT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcagcggagaggaccacccagagttcccgaaggaaatagtgcagcagaacgc
cggcacgcgaacagcaccaagaaggaccggctgcctcaggaggcacagaggacatggcta
aggattgtggcccttggggtcagccttgctctggtcacattcctgctctggagtagtgca
gggatcgatgatgatgttgctgaagttgtggcccatcgtggtgaggtcctagaaggcagg
ttcattgaggttccctgctctgaggactatgacggtcaccgaaggtttgaaggctgcacc
cccaggaagtgtggccgaggtgtcactgacatcgtcatcaccagggaggaggcggagcag
attcgcagaatagcagagaaagggctctccctaggtggatcggatggaggggcatctatc
ctggacttgcactcgggagccctgtctgttgggaaacactttgtgaacctgtatagatac
tttggggataaaatacaaactatcttctccgaggaggactttcagttatatagggacatt
cggcagaaggtccagctcaccattgctgaagctttcggcatccgtgcatccttgttgtat
ctgacaaagcccacattcttctcccgaataaatagcacagaagcccagacggctcacgac
gagtactggcatgcacacgtggacaaggtgacctacggctcttttgactacacttcgctg
ctttacctatcggattacttagaggacttcggtggagggcgctttgtgttcatggaggaa
gggtccaacaagacagtggagcccagagctggtcgagtctcattctttacttcaggttct
gagaacctgcaccgagtggagaaagtcctctggggcacccgctacgccatcaccatcgct
ttcacctgcaaccccgaccacggcatcgaggacccagtactcacgtga

DBGET integrated database retrieval system