KEGG   Rattus norvegicus (rat): 303763Help
Entry
303763            CDS       T01003                                 

Gene name
Zfp207
Definition
(RefSeq) zinc finger protein 207
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SSP160 zf-FCS
Motif
Other DBs
NCBI-GeneID: 303763
NCBI-ProteinID: NP_001034109
RGD: 1308121
Ensembl: ENSRNOG00000000236
UniProt: Q498C9
Position
10q26
AA seq 464 aa AA seqDB search
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKE
TIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDE
SAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPG
MPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQA
QAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQAQAAVQGPVGTDFKPLNSTPAATT
TEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEE
RRAQLPKYQRNLPRPGQTPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQG
MPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgcaagaagaagaagcagctgaagccgtggtgctggtattgtaacagagatttt
gatgatgagaagatccttatacagcaccaaaaagcaaagcattttaaatgccacatatgt
cataagaaattgtacacaggacctggtttagctattcattgcatgcaggtgcataaagaa
accatagatgcagtaccaaatgcaatacctgggagaacagacatagaattggaaatatat
ggcatggaaggtattccagaaaaggatatggatgaaagacggcgacttcttgaacagaaa
acacaagagagtcaaaaaaagaaacaacaagatgattctgacgaatatgatgatgacgaa
tctgcagcctcgacttcctttcagccacagcctgttcaacctcagcaaggttatatccca
ccaatggctcagccaggactgcctccagttcctggggcaccaggaatgcctccaggcata
cctcccttgatgcccggtgttcctcccctgatgccaggcatgcccccagttatgccagga
atgccacctggattgcatcatcagagaaaatacacccagtcattttgcggtgaaaacata
atgatgccaatgggtggaatgatgccacctggacctggaataccacctctgatgccgggt
atgccaccaggtatgcccccacctgttccacgtcctggaattcctccaatgactcaagca
caggctgtttcagcaccaggtattctcaatcgaccacctgcaccgacagcagcagtaccc
gctccacagcctccagttactaagcctcttttccccagtgctggacaggctcaggcagct
gtccaaggacctgttggtacagattttaagcccttaaatagtacccctgcagcaacgact
acagaacccccgaagcctacattccctgcttatacacagtctacagcttcaaccactagt
acaacaaacagtactgcagctaaaccagcagcttcaataacaagtaagcctgctacactg
acaaccaccagtgcaaccagtaagttgatccatccagatgaggatatatcactggaagaa
agaagggcacagttacctaaatatcagcgaaatcttcctcgaccaggacaaactccgatt
ggtaatccaccagttggaccaatagggggcatgatgccaccacagccaggcataccacag
cagcaaggaatgaggcctccaatgccacctcatggtcagtatggtggtcaccatcaagga
atgcctggttatcttcctggcgctatgccaccatatggacagggaccaccaatggtgccc
ccttaccaaggtgggcctcctcgacctccaatgggaatgagacctcctgtaatgtcgcaa
ggtggccgttactga

DBGET integrated database retrieval system