KEGG   Rattus norvegicus (rat): 303796Help
Entry
303796            CDS       T01003                                 

Gene name
Zdhhc8
Definition
(RefSeq) zinc finger, DHHC-type containing 8
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303796 (Zdhhc8)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     303796 (Zdhhc8)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   GRIP associated proteins
    303796 (Zdhhc8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 303796
NCBI-ProteinID: NP_001034110
RGD: 1308875
Ensembl: ENSRNOG00000021891
UniProt: Q2THW6
Position
11q23
AA seq 762 aa AA seqDB search
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAIPVYNGILFLFVLA
NFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHC
SVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLLYVLNHSEGLGA
AHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCYGNV
EHVLCSPLAPRYVVEAPRMPLSVSLKPPFLRPELLERAVPLKVKLSDNGLKAGRSKSKGS
LDQLDEKPLDLGPPLPPKMEAGTFGRDLKTPRPGSAESALSVQRTSPPTPAMYKFRPAFS
TAPKTPFCGPSEQVPGPDSLTLADDSTHSLDFVSEPSLDLPDHGPGGLHPTYPPSPPLSA
TDAFSGALRSLSLKAASRRGGDHMTLQPLRSEGGPPTPHRGLFAPHALPNRNGSLSYDSL
LNPGSPSGHACPTHPSVGMAGYHSPYLHPGPSDPPRPPPRSFSPVLGPRPREPSPVRYDN
LSRTIMASIQERKDREERERLLRSQTDSLFGDSGVYDTPSSYSLQQASVLTEGPRGSVLR
YGSRDDLVAGPGFGGARNPALQTSLSSLSSSMSRAPRTSSSSLQADQANNNAPGPRPGSG
SHRSPARQGLPSPPGTPRSPSYSGSKAVAFIHTDLPDRQPSLAMQRDHPQLKTPPSKLNG
QSPGMARLGPAASPMGPNASPARHTLVKKVSGVGGTTYEISV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcagccccgggacgcgcctcaaacccgccaagtacatcccggtggccacggcc
gcggcgctgttggttggctccagcaccctcttcttcgtattcacgtgcccgtggttgaca
agagctgtctctccagctattcctgtctacaatggcatcctcttcctctttgtcctggcc
aacttcagtatggctaccttcatggaccccggagtcttcccccgagcggacgaggacgag
gacaaggaggatgacttccgggccccactgtacaagaacgtggatgtgcggggcatccag
gtccgcatgaagtggtgtgcaacatgccacttctaccgtccgccgcgctgctcacactgc
agcgtctgcgacaactgtgtggaggactttgaccaccactgcccctgggtgaacaactgc
atcggacgccgtaactaccgttacttcttcctgttcctgctgtcactcagcgcacacatg
gtgggggtggtggccttcggcctgctctacgtgctcaaccactcggaggggctgggggcg
gcccacaccaccatcaccatggctgtcatgtgtgtggctggccttttcttcattcctgtc
atcggcctcactggcttccacgtggtactggtcacccggggacgcaccaccaatgagcag
gtgactgggaagttccgcgggggtgtgaatcccttcacccgaggctgctatgggaacgtg
gagcacgtgttatgcagtcccctggcgccccggtatgtggtggaagctcccaggatgcca
ctctcagtgagcctaaagccacccttcctgaggcctgagctcctggaacgagctgtgccc
ctcaaggtcaaactcagcgacaatgggctgaaagctggccgcagcaagtctaagggcagt
ctagaccagctggatgagaaacctctggacctgggacctccactgccccccaagatggag
gctggcacctttggaagagatctgaagaccccaagacctggcagtgctgagagtgccctg
tcagtacagaggaccagccccccaacacctgccatgtataagttccggccagccttctcc
actgctcccaagacacccttttgtggacctagtgagcaggtcccaggccctgactccctc
actctggccgatgacagcacccacagtctagactttgtatcagagcccagcctggatctc
ccagaccatgggcctggtggtctgcatcctacctaccctccctccccacccctcagtgcc
actgatgccttctcaggtgccttacgctccctgagtctcaaggctgccagtcggcggggt
ggggaccacatgaccttacagccactgcgctctgaaggtgggccccctacaccccaccgt
ggtctctttgctcctcacgcactgcccaaccgaaatggcagcctgtcatacgacagccta
cttaaccctggctcacccagtggccacgcatgccccacacacccctctgttggtatggcc
ggctaccattcaccctacctgcaccctgggccatcagatcctccacggcccccaccccgc
agcttcagccctgtgctgggtccccggcctagggagccctctcctgtgcgctatgacaac
ctgtctcggaccatcatggcctctatccaggagcgcaaggacagagaagagcgtgaacgg
ctgctgcggtcccagactgactcactctttggcgactctggtgtctatgacacacccagc
tcctacagcctgcaacaggccagtgtgttaacagaaggtccccgcggctctgtgctgcgc
tatggctccagggatgacctcgtggccgggcctggctttggtggtgcccgaaatcctgcc
ctgcagacatcattgtcctcactgtccagctccatgagtcgggcacctcggacatcctcc
tcttccctgcaggctgaccaggccaacaacaatgccccaggaccccggcctggcagtggt
tcacacaggtcacctgcccgtcagggcctgccttccccaccaggcaccccccgatcgccc
tcctactcgggctccaaggctgtcgccttcatccacacggaccttccggaccggcagccc
tcactggctatgcagagggatcaccctcagctgaagacccccccaagtaagcttaacggt
cagtccccgggcatggcccggctggggcctgctgccagccccatggggcccaacgccagc
cctgcccggcacacgctggttaagaaggtgtccggcgtgggtgggactacgtacgaaatc
tcggtgtga

DBGET integrated database retrieval system