KEGG   Rattus norvegicus (rat): 303875
Entry
303875            CDS       T01003                                 

Gene name
Nrros, Garpl1, Lrrc33, RGD1310771
Definition
(RefSeq) negative regulator of reactive oxygen species
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_5 LRR_9 LRR_6 LRRNT
Other DBs
NCBI-GeneID: 303875
NCBI-ProteinID: NP_001020166
RGD: 1310771
Ensembl: ENSRNOG00000001752
UniProt: Q5BK65
Position
11q22
AA seq 692 aa
MEFLPLWLCLGFHFLIVEWRSGRGTATAASQGGCKVVDRVADCRSLNLASVPSGLPAHSR
MLVLDANPLRVLWNHSLQAYPRLEDLSLHSCHLDRISHWAFHEQGHLQNLVLADNRLSEN
YKESATALHTLLRLRRLDLSGNSLTEDMAALMLQNLSSLEVVSLARNTLMRLDDSVFEGL
ERLVELDLQRNYIFEIEGGAFDGLTELRRLNLAYNNLPCIVDFSLTQLRFLNVSYNILEW
FLAAREEAAFELEILDLSHNQLLFFPLLPQCGKLHTLLLQDNSMGFYRELYNTSSPQEMV
AQFLLVDGNVTNITTVSLWEEFSSSDLSALRFLDMSQNQLRHLPDGFLKKTPSLSHLNLN
QNCLTKLHIREHEPPGALTELDLSRNQLAELHLAPGLTGSLKNLRVFNLSSNQLLGVPTG
LFHSASSITTLDMSHNQISLCPQTVPLDWEEPSSCVDFRNMASLRSLSLDGCGLKALQDC
PFQGTSLTHLDLSSNWGILNGSVSPLSAVAPTLQVLSLRNVGLGSGAAEMDFSGFGNLRE
LDLSGNSLTSFPKFKGSSALQTLDLRRNSLTALPQRVVSEQPLRGLQTIYLSQNPYDCCG
VEGWGALQHFKTIADLSMVTCNLSSKIIRVVELPEGIPQDCKWGQVDTGLFYLVLILPSC
LTLLVASTVIFLTFKKPLLQVIKSRCHWSSIY
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggagttcctgcccctgtggctttgcctgggttttcacttcttgattgtggaatggagg
agcggacgtgggacagctactgcagcttcccaaggaggctgcaaggtggtcgaccgagtc
gctgactgccgcagtctgaacctcgcttcagtacccagcggcctcccggcccattcccgg
atgctcgttctggatgccaaccctctcagggttctgtggaatcattccctccaggcctac
ccacgcctggaggacctcagcctgcacagctgtcacctggaccgtatcagccactgggcc
ttccatgagcaaggccacttacaaaacctggttctggcagacaaccgcctctccgagaac
tacaaggagtcggccacagctctccacaccctgctgcgacttcgaagactggacttgtct
ggaaactccctgacagaagacatggcagctctcatgcttcagaacctctcctcattggag
gtcgtgtccttggcaagaaataccctcatgaggctcgacgactctgtcttcgagggcctg
gagcgcctcgtggagctggatttgcagagaaactacatctttgagatcgagggcggtgcg
tttgacggcttgactgagctgaggcgtctcaaccttgcctacaacaacctcccctgcatc
gtggacttcagcctcacacagttgcggttcctcaacgtcagttacaacatcctggagtgg
ttcctggcagccagggaagaggcggccttcgaactggagatactggacctgtctcacaac
cagctgctcttcttcccgctcctgcctcagtgtggcaagctgcacacgctcctgctgcag
gacaacagcatgggcttctacagggagctttacaacacctcctccccacaggagatggtg
gcccagttccttctcgtggatggtaatgttactaatatcacaaccgtcagcctctgggag
gagttctcctccagcgacctgtcagcgcttcgcttcctggacatgagccaaaaccagttg
cggcacctgccggatggtttcctgaagaaaacgccttccctttcccacctgaacctcaac
caaaattgcctgacgaagctccacattcgggagcacgagccgccgggagcgctcactgag
ctggatctgagccgcaaccagctggcagaactgcacttggcccctgggctcactggttcc
ctcaagaacctcagagtgttcaacctgagctccaaccagctcctgggagtccccactggc
cttttccacagcgccagcagcatcactacacttgacatgagccacaatcagatctcactt
tgtccccagacagtgcccttagactgggaggagccctccagttgtgtggatttcagaaac
atggcctctttgaggagcctttctctggatggctgtgggctgaaggcattacaagactgc
ccattccaggggacctccctcactcatttagatctgtctagcaactgggggattctgaat
gggagcgtcagccctctctcggctgttgcccctacattacaggtcctgtctctcaggaac
gtgggccttggttctggcgctgcagagatggacttctctgggtttgggaatctgagggag
ttggatctgtcaggaaattccctgaccagcttccccaagttcaagggcagttcggccctg
cagactctcgacctccgcagaaactctctcacagccctacctcagagggttgtgtcggag
cagcctctgaggggtctgcagaccatctacctcagccagaacccttatgactgctgtggg
gtggagggatggggggccctgcagcacttcaagactattgcggacctgtccatggtcact
tgcaacctctcttccaagatcattcgtgtggtagagctgccagagggcatacctcaggac
tgtaagtgggggcaggtggacactggtctattctacctcgtgctcattctgcccagctgc
ctcaccctgctggtggccagcaccgtcatcttcctcacttttaagaagcctttgcttcag
gtcatcaagagccgctgtcactggtcctccatatactga

DBGET integrated database retrieval system