KEGG   Rattus norvegicus (rat): 303879
Entry
303879            CDS       T01003                                 

Gene name
Slc51a, Osta, Ostalpha, RGD1311100
Definition
(RefSeq) solute carrier family 51, alpha subunit
  KO
K14360  organic solute transporter subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    303879 (Slc51a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    303879 (Slc51a)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC51: Transporter of steroid-derived molecules
   303879 (Slc51a)
SSDB
Motif
Pfam: Solute_trans_a
Other DBs
NCBI-GeneID: 303879
NCBI-ProteinID: NP_001100557
RGD: 1311100
Ensembl: ENSRNOG00000001765
UniProt: D4AC81
Position
11q22
AA seq 340 aa
MEPGRTHIKLDPRYTADLLELLETNYSISPACFSHPPTAAQLLRELGSVEIALTIILTFF
TIGSVAIFLEDAIYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAIT
SFYAVCFYLLMMVMVEGFGGKEAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLL
MLGPFQYAFFKIVMSIVGLFLIPDGIYDPAEISEKSAALWISNFLAVSTLLALWSLAILF
RQAKLHLGEQNMGSKFALFQVLVILTALQPSIFSILANSGQIACSPPYSSKIRSQVMNCH
MLILETFLLTVLTRMYYRKKDNKVGYEACLPPDLDSTLKA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagccaggcaggactcatataaaacttgaccccaggtacacagcagatcttctggag
ctgctggaaaccaattacagcatctcccctgcctgcttctctcaccctcccactgcagcc
cagctcctgagagaattgggctcagtggaaattgccctcaccatcatcttgacctttttt
accattggatcagttgccatttttctggaggatgctatttacctatacaagaacaccctt
tgccccatcaagaagaggactctgatctggagtagctctgcgcccacggtggtgtctgtg
ttctgctgctttggtctctggatcccacgtgccctcacacttgtggaaatggccataacc
tcgttttatgccgtatgcttttacctgctgatgatggtcatggtggaaggctttggtggg
aaggaagcagtactaaggacactgaaggacaccccaatgagggtgcacacaggtccctgc
tgctgctgctgtccctgctgcccacccctcatacttaccaggaagaagctacagttgctc
atgttgggccctttccagtatgccttcttcaagatagtgatgagcatagtgggcctgttt
ctcattcctgatggcatctatgacccagcagaaatttctgagaagagcgcagctctctgg
atcagcaatttccttgctgtgtccacccttttggctctctggtccctggccatccttttc
cgtcaagccaagttgcacctgggtgaacagaatatgggatccaagtttgctctgttccag
gtgcttgtcatcctgaccgccctgcagccctccattttctccatcttggctaacagcggg
cagatcgcttgctcacctccctattcttctaaaatcaggtcccaagtgatgaactgtcac
atgctcatcctggagaccttcctgttgacagtgctgacacgcatgtactatcgaaagaaa
gataacaaggttgggtatgaggcttgtttaccgccagacctggactcaacgctcaaagcc
tga

DBGET integrated database retrieval system