KEGG   Rattus norvegicus (rat): 303886Help
Entry
303886            CDS       T01003                                 

Gene name
Muc20
Definition
(RefSeq) mucin 20, cell surface associated
  KO
K22021  mucin-20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    303886 (Muc20)
Membrane trafficking [BR:rno04131]
 Others
  Mucins
   Membrane bound mucins
    303886 (Muc20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 303886
NCBI-ProteinID: NP_001100559
RGD: 1304865
Ensembl: ENSRNOG00000001776
UniProt: B2RZ35
Position
11q22
AA seq 415 aa AA seqDB search
MMSSVWGLAVPLLVFYWKVGVSVSSPGTLAPSDSPRAGMTTVKAGTVSDPIEAVLGTLCT
DDSSEETRKITIDLLTLAHPSMGVEQLSSESSSSSDSSAGVLSSSQALGPDSTTPAKDSV
AFSISHIKLTTCITEIETTITISGTPDASRSPAEAMTALSASEMLTLPPSTEAKPVVPKT
TSSSGILSTATTLALATTLEGTLPASGITESEIAVAQTPTSSGTSATGGTQVTVRRNPLE
DTSALSSETQSHTEVFGTITVPTVAGSTVGEATSLVSSTALDSSLSAVVTTKGSASSETL
TTDNTTNSSFLTGSRPPSLIYSTTASTSERTNVTLTKTTASPKTPMNPAPTAWTRKTTEH
DPGINGGFLLVRLTVASPKDLTEHVTREKLMHQLRRELHTHMPLVQVSLLSIRRS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctgtctggggcctggctgtaccgctccttgtcttctactggaaggttgga
gtcagtgtgagctctccagggacattggcaccaagtgacagccccagagctgggatgacc
actgtcaaagctggcacagtgagtgaccccatagaagccgtccttggcaccctttgtact
gatgacagctctgaagagacaaggaagatcacaattgacctcctgactttggcacacccc
tccatgggagtggagcagctgtcttcagagagcagctcctcctctgacagctcagctggg
gtcctcagcagctctcaggccctgggacccgacagtacaactccagccaaggactcagtt
gccttcagcatctcccatattaagctcaccacctgcatcacggaaatagaaacaaccatc
accatctctgggaccccagacgcgagccgcagccctgcagaagcaatgacagctttatct
gcttctgagatgttaactttgcctccatccactgaggcaaagccagttgtccctaagacc
acaagctcatctgggatcctgtcaactgccactaccctggcccttgccaccacccttgag
ggtacactccctgctagtggaatcacagaaagcgaaatagcagtggcccagactcctacc
tccagtggaacttcggctacaggaggaacccaggtgacagttagaaggaacccactggaa
gacacttcagcactctctagtgagacacaaagccacactgaggtttttggtaccatcaca
gtccccacggttgctggatcaacagtaggagaagcaacctctcttgtgagttccacagct
ctagacagcagtctctcagcagtggtcaccaccaagggctctgcttcctcagagacttta
accacagacaatacaaccaacagctccttcctcacagggagtcgccctccttctttaatc
tattcgacaacagctagcaccagtgaaagaacaaacgtcactttaaccaagaccacagcc
tcaccgaagaccccgatgaatcccgcacccactgcttggacaaggaaaaccacagagcac
gatccaggtataaatggaggcttcctccttgtacggctgaccgtggcctcccctaaggac
ctcactgagcacgtcaccagagagaagctgatgcaccagctccgccgtgaactgcacacc
catatgccacttgtccaagtgtccttactgagcatcaggaggagctga

DBGET integrated database retrieval system