KEGG   Rattus norvegicus (rat): 303903Help
Entry
303903            CDS       T01003                                 

Gene name
Parp14, RGD1310490
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 14
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    303903 (Parp14)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     303903 (Parp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP RRM_occluded WWE
Motif
Other DBs
NCBI-GeneID: 303903
NCBI-ProteinID: NP_001178588
RGD: 1310490
Ensembl: ENSRNOG00000023334
UniProt: F1LZ05
Position
11q22
AA seq 1787 aa AA seqDB search
MAASGPFPLLVEGSWGPDPPKNLINKLQMYFQSRKKSGGGECEVVPEPGNPARFLVLFSP
EDVRQNVLEKENHELVWQGKGTFKMTVQLPADPGQASVSKKAIPEEESKTKEDAVKPGDL
DTTPSPSSRSEEMEDVPKECENISSMVAFEQLPEKVSEMVLTFLVENISGLPSDDFKVEL
IRDFAVAVVTFQKPIDTKKFIIDCISHRSNQQLQLVPRLLETTNVVRVENLPPGVDDYQL
QLFFENPFNGGGRVARVECFPEESSALVEFCDSKVLDTIMAKKHSFNKMPLSVFPYYPSL
GTALYGEEKPLVKLPASFQESLDLPLWKFFQKNDHLMEEINDEMRHCHCELTWSEINGKL
TVRPAATLVSHRPSIKTWQRDASAALSGIRSKYDVMVFEVCSPVWDIIKHELGDDRVLIE
FEKESLNVAGKSEDVQGISQQIRELIERTTEKLRREEQSLEEKVAISSGKHFLLYHSGFL
KDLSKEYPEMEISYDATAQYLCIKGLRADVYKVKCEIQEKVFSMAQKNVPVSSEVFRFLQ
QVDGQRLSNALFKAQNILATYELKDNALFLIGSSPKDLAEAEAKMLSALSHKHIEVEDKE
VLRSNVWKKKIHPLQKRHGSYAAIMVKNELTSGVPAEVVIAGCVKEVNEIHRQLFEFLEN
HMKVERVVKIDPPLIIDYLKTDKRLLSKTKKANVSVSFKTKDDPNSILLLGSKSKVLECL
DTVKEIRDSVCVRKFQTDKAGARHFFQDKEFYYKMEIRRLYGCIVELKEGEEGEEDSLKE
QKCYLQRDIGPGVTLIVHEGDLSLFPVDVVVNAANESLKHIDGLAGTLSKAAGPSLQAEC
DLIVKKGGMVPPGNAVISKAGKLPCRYVIHAVGPRWKGDKVLECVNLLKKAVKQSLTLAE
EYKCQSIAIPAISSGIFDFPLDLCVASIASAIKDNVQQKQNTHSVKKIYLVDVSAKVAKA
FAEAVKTTYRDILSPASVKALVPPGKMPQKQGKLLVSPEGLNIRLIEEGVQNAEAHAIVN
SVSSDLILNKGPLSQAFLESAGPELQEELTKAGQGVSVSVGTVLQTSGCNLNSRSIFHVV
TPPWKSNNSEWSLKIMKNIIRDCLRTTEDLSLQSIAFPAIGTGNLGFPKPEFAKLIISEV
LKFSSRNQLKTLQEVQFLLHPKDHENIQAFLDEFDKRSNGDPSSKNPKAEDTQGIYGSLS
SPTLGVHEMNIGPILFQVATGDIIKEVADVIVNSTSCTFNLKSGVSKAILEGAGQNVEQE
CSRLAQQGKEYIVTGGGLLKCKSIIHVDGGNDVKRSVSCILEECEQRSFSSICLPAIGTG
SAQQDPKVVAKAVLDAIEEFVQKKSVQAVKRVKVVIFQPHILQFFYDNMKEREGSPAPVK
PSVMSKIASFLGFPTQASPPKNTLVLEKKIELTVFQICGPGVDSVEGTISWLKSLITKEQ
FSFTNEDECVRDFDTEEYRKLNEMQKRLNIIIELNQKKPLIKVSGISRDVVEARDEIDNM
VKSIRLAKEKENQADYVSTFVEWQYIANNTTRCFDKIANMQLEDAWKAKKKHTVVKIQNQ
DFTVDLSTNTATAPQGLSFTVQRLLKAEAEIPANWSDMKQNKLLVVSLQTSDAEYTMVSR
AFHQTCPNFVIEKIERIQNPALWRRYQAYKKIMDEKNGNVINEKQLFHGTEFGSLAQLNS
NGFNRSYAGKNATAYGKGTYFAVNASYSAHDTYSKPDANGKKYMYYVRVLTGNYTQGNAS
LIVPPSRDPQNATDLFDTVADNVINPSIFVVFYDNQAYPEYLITFRK
NT seq 5364 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtcgggtcccttcccgctgctggtcgagggctcttggggtcccgaccccccg
aagaacttgatcaacaagttgcaaatgtacttccagagccggaagaaatctggaggaggg
gagtgcgaggtcgtcccggagcccgggaacccagcacgcttcctggtgctcttctccccg
gaggatgttcggcagaatgttctggagaaagagaatcatgagttagtgtggcaaggaaaa
ggaacattcaaaatgaccgtccagttgcccgcagacccagggcaagcctcagtctctaag
aaggcaattccagaagaggagtccaagacaaaagaagatgctgtgaaaccaggtgatttg
gacacaacaccttctcccagcagcagatcagaagaaatggaagatgtcccaaaagaatgt
gaaaatatttcctccatggtggcatttgaacaactgcccgagaaagtatcggagatggtg
ctgaccttcctggtggagaatataagtggcctccctagtgatgattttaaggtggaattg
atccgagatttcgctgttgctgtggttacctttcagaagcctatagataccaaaaaattt
attattgattgtatcagccaccgctcaaatcaacaactccaacttgtcccgagacttctg
gaaacgaccaatgtagtgagggtggagaacctgcctcctggggtggatgattaccagctg
caactcttctttgaaaaccctttcaacgggggtggtagggtcgcccgagttgagtgtttc
cccgaagagagttcggcgctggttgagttttgtgacagcaaagtgttagacaccattatg
gccaagaaacacagtttcaacaagatgccgctgtctgtcttcccatattacccctccctg
ggcacagccttgtatggtgaggagaagcctctggtcaagcttccagcatctttccaggag
tccctggatcttcctttgtggaagttctttcagaaaaatgatcatctgatggaggagata
aatgatgaaatgaggcactgtcactgcgagctgacgtggtctgaaatcaacggtaaactg
accgtcagaccggccgccaccttagtcagtcacagaccgagcatcaagacctggcagagg
gatgcgtccgcagcactctctggcatcaggtctaaatatgatgtgatggtgtttgaagtg
tgctcgccagtatgggacatcataaagcatgagttaggagatgacagggttttgattgag
tttgagaaggagagtctgaatgtagcaggaaaatcagaagatgtccaaggcattagccag
caaatcagggaactaatagagcgcaccactgaaaagctcagaagggaagagcagagtctg
gaggagaaagtggccatttcctcgggaaagcattttcttctgtaccacagtggcttcctg
aaggatctaagcaaagagtacccggagatggagatctcttacgatgccacggctcagtac
ctgtgcattaaaggcctccgtgcagatgtgtacaaagtaaagtgtgaaatccaagaaaag
gtgttttccatggctcagaaaaatgtcccggtttcttccgaagtcttcagatttctgcag
caagtagacggtcagagactctccaatgctctgttcaaggctcagaacattcttgccaca
tacgagctgaaagataacgctcttttcttaattggaagttctcccaaagatctggcagaa
gctgaggccaaaatgctcagtgctttaagtcataagcacattgaagttgaggacaaggaa
gttctgagaagtaatgtgtggaagaagaaaattcaccctctgcaaaagagacacggctcc
tacgcagccattatggtcaagaatgagttgacgtcgggagtcccggctgaggtcgtcatc
gccggctgtgtgaaagaagtcaatgaaattcataggcagcttttcgagtttttggaaaac
cacatgaaagttgaaagagtggtcaaaatcgatccacccttgattattgactatttaaag
acagacaagaggctactgtcaaagacaaagaaggcaaatgtgagtgtgagtttcaagact
aaagatgatccaaacagcattttgttacttggctccaagagcaaagttctagagtgcctg
gatacagtcaaggaaatccgggattcagtctgcgtcagaaaattccagactgacaaagcc
ggtgccaggcacttcttccaggataaagaattctattacaaaatggagatcagacgtctg
tatggatgcatcgttgaactgaaggagggtgaagagggggaggaagacagccttaaggag
cagaagtgctacttacagagggacataggccctggggttacactgattgtccacgaggga
gacctgagtctgtttcctgttgatgtggtagtgaacgcagccaatgagagccttaagcac
atcgatggcctcgcgggcactctctcaaaggctgcgggccccagcctccaagcagaatgt
gacctgatcgtgaaaaagggaggcatggtcccacccggcaatgctgttatctcaaaagca
ggcaagctcccttgtcgttatgtcatccatgccgtagggcctcgatggaagggagataag
gtcctggagtgtgtgaacctcctgaagaaagctgtgaaacaaagtctcactttagctgaa
gagtacaagtgccagtccatagccataccagcgatcagctctgggatctttgattttccc
ttagacctgtgcgtggcatccattgcttcagccatcaaggacaacgtccaacagaagcag
aacacgcactccgtgaaaaagatttatctggtggacgtatctgcaaaggttgccaaggcc
tttgctgaagctgtcaagactacatatagagatatcctttctccagccagtgttaaagca
ttagtaccacctgggaaaatgccccagaagcaaggcaagctgctggtgtcaccagaaggc
ttgaacatccgcctgattgaagaaggtgtgcagaatgctgaggcccatgccattgtgaac
tctgtttcctcggatcttatactcaacaaaggacccctttctcaggctttcttggaaagt
gctgggccagaactccaggaggaattgaccaaggcaggacaaggggtctctgtcagtgtg
ggtacagttcttcaaaccagcggctgtaatctgaacagccgctccatcttccacgtggtg
accccaccatggaaaagcaacaacagcgagtggtcactaaagatcatgaaaaacatcatc
cgtgactgtctgaggaccaccgaggacctgtctctacaatccattgcatttccagcaata
ggaacgggaaatctggggtttcctaaacccgaatttgctaaattgataatttcagaagta
ctcaaattcagtagcaggaaccaactgaagactttacaagaggttcagtttctgctgcac
cccaaggaccatgaaaacattcaggcatttttagatgaatttgacaaaaggagtaatgga
gatcctagtagcaagaatcccaaggctgaagacacacaaggtatctatgggagtctttcc
agccctactttaggagtgcatgagatgaatattggcccgatcctcttccaagtggccacc
ggggacatcatcaaagaagtggcagatgtgattgtcaattccacatcatgcacgtttaat
ctcaaatcaggggtctccaaagcaattttggaaggtgcaggacaaaatgtggagcaagag
tgttctcgcttggctcaacagggtaaagagtacatagtcactggaggtggattattgaaa
tgtaagagtattattcatgttgatggtgggaatgatgtcaagagatcagtttcctgtatt
ttggaagaatgtgaacaacgcagtttctcatccatttgtctaccagctattggcacagga
agcgctcaacaggatccaaaggtagtagcaaaagcggtattggatgccattgaagaattt
gtccagaagaaatcagtgcaggctgtgaagagagttaaagttgttatcttccagccccat
attctgcaatttttctatgacaacatgaaagaaagagaaggttctccagctcctgtcaag
ccgtcagtgatgtctaagattgcctccttccttggctttccaacacaagcttcaccccca
aagaacaccctggttttggaaaagaaaattgagctcacagttttccagatatgtggccca
ggtgtagacagtgtggaaggtacaatctcctggctaaagagtctgattaccaaagagcag
ttttccttcaccaatgaggacgagtgtgtcagagactttgacaccgaggagtacaggaaa
ctgaatgagatgcagaagaggctgaacatcatcattgagctgaaccagaagaaacctttg
attaaagtctcaggaatcagcagagacgtggtagaagctagagatgagattgacaacatg
gtcaagagcattagattggctaaggaaaaggaaaaccaggcagactacgtctctacattt
gtggaatggcaatatattgctaataacaccacacggtgttttgacaagatagccaacatg
cagttggaggatgcatggaaggcaaagaagaagcacactgttgtcaaaattcagaatcag
gacttcacggtggacttgagcacaaacacagccacggctccccaaggactgagtttcact
gtccagcgactcctcaaagctgaagctgaaattcctgccaattggagtgatatgaagcag
aacaaattgcttgtggtgagtctgcaaaccagtgatgccgagtacaccatggtatccagg
gccttccatcagacctgcccaaactttgtcatagagaagattgaaaggattcaaaatcca
gctctttggaggaggtaccaggcgtacaaaaaaattatggatgaaaagaatggcaatgtg
ataaatgagaagcaactcttccatgggacggagtttggctctctggcacagctcaacagt
aatggatttaaccgcagctatgctgggaagaacgctacagcctatgggaaaggaacctat
tttgcagtcaatgcttcctattctgcccatgacacatattccaaaccagatgccaatggg
aaaaagtatatgtattatgtgcgggtcctcactggaaactacacacaaggaaacgcatca
ctgattgtgcctccttcaagggaccctcaaaatgctactgacttgtttgacactgtcgca
gataatgttataaatccgagtatatttgtagtgttttatgacaatcaagcataccctgag
tatcttatcacatttaggaagtaa

DBGET integrated database retrieval system