KEGG   Rattus norvegicus (rat): 303918
Entry
303918            CDS       T01003                                 

Gene name
Gtf2e1
Definition
(RefSeq) general transcription factor IIE subunit 1
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    303918 (Gtf2e1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    303918 (Gtf2e1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    303918 (Gtf2e1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     303918 (Gtf2e1)
 Prokaryotic type
  Archaeal type
    TFE
     303918 (Gtf2e1)
SSDB
Motif
Pfam: TFIIE_alpha TFIIE-A_C TF_Zn_Ribbon OrfB_Zn_ribbon Elf1
Other DBs
NCBI-GeneID: 303918
NCBI-ProteinID: NP_001094026
RGD: 1306851
Ensembl: ENSRNOG00000026008
UniProt: G3V992 Q4FZQ9
Position
11q21
AA seq 438 aa
MADPDVLTEVPAALKRLAKYVIRGFYGIEHVLALDILIRNPCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERN
STNRASFKCPVCCSTFTDLEANQLFEPMTGTFRCTFCQAEVEEDESAMPKKDARTLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDRAASAAGAAGLAGGHHREAWT
NKGPSYEDLYTQNVVISMDDQDDVHRTSLEGKAAKERPIWLRESTVQGAYGSEEMKEGGI
DMDTFQDREEARAGPDDNEEVMRALLIHEKKTSSATAGSVGAAAPVTAANGSDSESETSE
SDDDSPPRPAAAAPHHRDEDEEDDEFEEVADDPVVMVAGCPFSYSEVSQRPELVAQMTPE
EKEAYIAMGQRMFEDLFE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcagacccagatgttctcactgaagttccagcagcattgaagcggttagccaagtat
gtcatccggggcttttatggcattgagcatgtgttggccttggacatcttgatccggaac
ccttgtgtaaaagaagaggacatgctggagctgctcaagtttgaccggaagcagcttcga
tccgttttgaataatttaaagggagacaagttcatcaaatgcagaatgagggtagagact
gctgcagatgggaagaccacccgccataactactacttcatcaattaccgcactcttgtt
aatgtagtgaagtataagctggaccacatgagaaggaggattgaaacggatgagagaaac
tccaccaatcgggcttccttcaaatgtcctgtctgctgcagcactttcactgacctggaa
gctaatcagctgtttgaacccatgacaggaactttccgctgcaccttttgccaggcagag
gtagaagaagatgaatcagcaatgcccaaaaaagatgcgcgcacacttttggcaaggttt
aatgaacaaattgagcccatttatgcattgcttcgagagacagaggatgtaaacttggcc
tacgaaatacttgaaccagaacccacggaaatcccagccctgaagcagagcaaggaccga
gcagcaagtgctgctggagcggctggcctggcaggtgggcaccaccgggaagcatggacc
aacaaaggcccctcttatgaagacttgtatactcagaatgttgtcatcagcatggacgac
caagacgatgtgcatcgcacctcgctggaagggaaagccgccaaagagagacccatttgg
ttgagagagagcactgtccagggggcgtacggttctgaagagatgaaggaaggtggcatc
gacatggacacatttcaggatcgagaggaagcccgtgcggggcctgatgacaacgaggag
gtcatgcgagctctactcattcatgagaagaagacgtcttcggcgacagctggctcagtg
ggagcagccgctccggtgactgctgccaacggcagtgactctgagagtgagaccagtgag
tcggatgacgactctccaccccggccagcagctgcagctcctcatcaccgcgatgaagat
gaggaagatgacgagtttgaggaagtagcagatgaccccgttgttatggtggctggctgc
ccattctcctacagtgaggttagccagcggccagagttggtagctcagatgacaccagaa
gaaaaggaagcctacatagccatgggccagcggatgtttgaggatctcttcgagtga

DBGET integrated database retrieval system