KEGG   Rattus norvegicus (rat): 303923
Entry
303923            CDS       T01003                                 

Gene name
B4galt4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00533  Glycosaminoglycan biosynthesis - keratan sulfate
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Module
rno_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    303923 (B4galt4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    303923 (B4galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    303923 (B4galt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     303923 (B4galt4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     303923 (B4galt4)
    2.4.1.-  
     303923 (B4galt4)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   303923 (B4galt4)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Other DBs
NCBI-GeneID: 303923
NCBI-ProteinID: NP_001012018
RGD: 1307880
Ensembl: ENSRNOG00000003114
UniProt: Q66HH1
Position
11
AA seq 344 aa
MGCNPPYLLSYRLRLLLLFTLCLTVLGWATSNYFVGAIQVIPRAKNFMATLHKVMYLGNE
ETLGHGAAMKKAELANCPSVSPNLRGQNKLVFKPDLTLEEVQAKNPKVSRGRYRPEECKA
LQRVAVLIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYVIHQTGSKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNGS
RMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgggctgcaacccaccttacctcctctcctacagattacggttgctgctgctctttacc
ttatgcctgacagtgcttgggtgggccaccagcaactactttgtgggtgctattcaagta
attcccagggcaaagaacttcatggctactttacacaaggtcatgtatttggggaatgaa
gaaactctgggccatggggcagccatgaagaaagcagagcttgctaactgcccttcggtg
tctccaaacctcagagggcagaacaagcttgtttttaagccggacctcactttggaggaa
gttcaggctaaaaaccccaaagtgtccagaggccggtatcgcccagaggagtgtaaggcc
ctgcagcgggtggcggtcctcatcccccaccggaacagagagaagcacctgatatacctg
ctggaacacctgcatcccttcctgcagaggcagcagctggactacggcatctacgtcatc
caccagaccggaagtaaaaagtttaaccgggccaagctcctcaacgtgggctatctggaa
gctctcaaggaggagaactgggactgcttcatattccacgacgtggacctggtgcctgag
aatgacttcaacctctacacctgcggggatcagcccaagcacctggtcgtgggccggaac
agcactggctacaggttgcgttacagtaaatattttgggggcgttactgccctcagcaga
gaacagtttttcaaggtgaatggattctctaacaactactggggatggggaggagaagac
gatgacctcagactcagggttgagctgcataaaatgaaaatatcccggcccaagcctgac
gtgggcaagtacaccatgatcttccacaccagagacaaaggcaacgaggtgaacgggagc
cgaatgaagctgttgcagcagatgtcacgggtctggaaaacagatggcttatcgagctgc
tcttacagattgctctctgtggaacacaaccctttatacgccaacatcacagtggatttc
tggaccgccgcgtga

DBGET integrated database retrieval system