KEGG   Rattus norvegicus (rat): 303946
Entry
303946            CDS       T01003                                 

Gene name
Usf3, RGD1560175
Definition
(RefSeq) upstream transcription factor family member 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HLH TFIIA Tau95_N
Other DBs
NCBI-GeneID: 303946
NCBI-ProteinID: XP_001067438
RGD: 1560175
Ensembl: ENSRNOG00000027756
UniProt: D4ABR5
Position
11q21
AA seq 2222 aa
MPEMTEHETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGSSEQAEEIKKLRKQLEEIQKENGRYIELLKANDICLYDD
PTIHWKGNLKTSKVSVVIPSDQVQKNIIVYSNGSQPGGNSQGTAVQGITFNVGHGLQKQT
ANVVPVQRTCKLVTPVSISGIYPSENKPWHQTTVSALAANQSVPLCLPTAISAQNILELS
TSESQSSALGATGGSVVTTSVGPDPHQHRSLNTCLNDQNASENSNVQESPKSSKKTVSSV
SGTSSSNSAAAPGVHHETKSSLATQGSSADSQNTLVSITTPVSSQPPRSTGSSSPVSVSK
TVDPTNTAAAVVPAHTAVSKSALPVSSLSATPLEGGWTLSCSLPSSSVSASELKNINSLT
RISSAGNTQTTWTTLHLAGNTIQPLSQPPSSASTPALNECGTSPTPSNHKHMATGITFNN
SPPTDGQPVEQIVVTLPSCPPLPMQPLIAQPQVKSQPPKNILPLNSAMQVIQMAQPVGSG
VTAAPANQNVIILQPPSTTPCPAMMRAEVSNQAVGQQIVIIQAANQNPLPLLSAPHPGPV
RLPVNGASAIIGSHNSVQNVPAPQTFGGKHLVHILPRPSSLSTSNSAQTFSVTMSNQQQP
QTISLNGQLFALQPVMSSSGTTNQSPMQIIQPTTSEDPNTNVALNTFGALASLNQSISQM
AGQSCVQLSISQSANPQTSANSQTSPTNCVSLTTVAPTMTAENSATQSTTYSLATASSTN
TVTCLPSTMKSKRLSKKPSAKKHLAANKPACPLNSVRDVGKMDGPGMDSSAEPSCSDGLL
NGLPVGLSSVTVSQAKSVSISASHSLDILNSESVIPESDSKSKSAEDCSSSSRESEANEQ
LALATAKSKDSTPILQESSQGTPPCSVALPNATKSCASANVLTPSPTESESLVSQVSGMP
STTSTSNTVCISEVEIVAEPCPVQQESLDTMQAAGPLKGQGLTMLLSDLAKEKDLQRTSL
PVQMDHPDFSPESSKIGDPNVDLHPKQELLLTSDDRDLPQPHSCLPDQEVIHGSLLTSRQ
ADSPMSTSSGSSRSFSVASMLPETAREDVTSSTTNTCDSCTFAEQTDIVALAARAILDQE
SIEKGRLGTQADLKDVTPKPSETSLEGDQPFKPQIHKETCTGQADPTPNEFNSQDSVEVT
VDRPLEKPSCSLGIKASNPPLQVSASQPPSLTHQNSISRPLVSCAGLSQSSDQTAIPVTV
NMTVASSAYGSQPPVPPLMTEYSQEQLNSMANSIPNPQVQEPLSKPSHESRKDSAKRTVQ
DDLLLSSAKRQKHCQPAPLRLESVPLMSRTPDNIPDQTQMMASQITPNSSNSVVPVSNPA
HGDGLTRLFPAGNNFAAPVLRQADVQCNPQPSVAEQPQQTQAGQHLQALQQHVPPQGVSH
LHTNHLYLKQQQQQQQAGQLRERHHLYQLQHHVPHADNAVHSQPHIVHQQRTLQQEVQMQ
KKRNLVQGTPTSQLSLQPKHHGTDQSRPKSSQPHPHHQQMQQQLQQHFASSQPEKSCENP
SSSRGHHSHPQNHLNQDVLHQQQDVGSRQQGSAVSSDHVSGHNPMQRLLPSRGLEQQMVS
QPSIVTRSSDMTCAPHRPERNRVSSYSAEALIGKSSSTSEQRLGISIQGSRVSDQLEMRS
YLDVPRNKSLALHNMQGRMDHTVTSDIRLSDCQTFKPGAASQQPQSNFEVQSSRNNEIGN
PAPSLRGMQSQAFRISQNTGPPPIDRQKRLSYPPVQSIPTGNAVPPRDSENTCHQSFMQS
LLAPHLGDQVIGSQRSLSEHPRNTQCGPSSTIEYNCPPARESVHIRRESESQNRESCDMS
LGAINPRNSTLNIPFSSSSSSGDIQGRNTSPNVSVQKSNPMRITDSHGAKGHMNPPVTSN
MHGVARPTLPHPSVSHGNADQGPPVRQANSSVAQRSRHPLQDSSGSKIRQPERNRSGNQR
HSNVFDPSLPHLPLSTSGSMILGRQQPAAEKRGSIVRFMPDSPQVPNDNSGPDQHSLSQN
FGFPFIPEGGMNPPINANTSFIPQVTQPSATRAPALIPVDPQNTLPSFYPPYSPAHPTLS
NDISIPYFSNQMFSNPSTEKVNSGSLNNRFGSILSPPRPVGFAQPSFPLLPEMPPMHMAN
SHLSNFNMTSLFPEIAALPDGSAMSPLLTIANSSASDSSKQSSNRPAHNISHILGHDCSS
AV
NT seq 6669 nt   +upstreamnt  +downstreamnt
atgccagagatgacagagcatgagacgcctacgaaaaagcagcacagaaagaagaaccga
gagacacacaatgcagtggagaggcacagaaagaagaaaatcaatgctgggataaacaga
ataggagaactgatcccatgctcccctgctctgaagcagagcaagaacatgatcctggac
caagcctttaagtacataacagaactgaagcggcaaaacgatgaactcctgcttaatgga
gggagcagtgaacaagctgaagaaataaaaaaactacggaaacaactagaagaaatccaa
aaagaaaatggccgatatattgaattgttgaaagcaaatgacatatgcttatatgatgac
cccacaatccactggaaaggaaatctgaaaacctcaaaggtgtctgttgttattccaagt
gaccaggtccagaaaaacatcattgtttattccaacgggagccaacctgggggaaacagc
caggggacagctgtccaggggataacctttaatgttggtcacggcttgcaaaagcaaacc
gccaatgtggtgccagtgcagaggacctgcaagcttgtgactcctgtgtctatttctgga
atttacccttctgaaaacaagccgtggcatcagactacagtgtctgcactggctgccaac
cagtctgttcccctttgtcttcccactgccatttctgctcaaaacattctcgaactttct
acttctgaaagccaatcaagtgcactcggtgccactggtggctcagtagtcaccacttca
gttggccctgaccctcaccaacatcgttccttgaatacatgcctaaatgatcaaaatgct
tcagaaaatagcaacgtgcaggagagccccaaatcatcaaagaaaacagtctcgagtgtc
tcaggcacctcctccagcaattcagcagctgccccaggggtgcaccatgaaaccaagtcc
agcctggccacacagggctccagtgcagactcacaaaacacccttgtgtcaattaccacc
ccagtgtcctcccagcctcccagatctacaggtagctcttctccagtgagtgttagcaag
actgtggacccaaccaatacagcagcagcagtggtaccagctcacactgcagtgtcgaag
agtgccctcccagtgagcagtctttctgcaactcctttggaaggtggttggactctttct
tgttctctgccttcctcaagtgtcagtgcttcagaattaaaaaacatcaacagtcttacc
cgaatctcttcagccggaaacacacagacaacatggactacattgcacctggccggaaac
actatccagcctttaagccagccaccatcttctgcttcgactccagcattaaacgagtgt
ggtaccagccctaccccaagcaaccacaagcatatggctacagggatcaccttcaacaat
tctcctccaacagatgggcagccagttgagcagatagtggtaactttgccttcgtgccca
cccttacctatgcaaccactaattgctcaaccacaagttaaatctcagcctccaaaaaat
atccttcccctgaattcggcaatgcaagtgattcagatggctcaacctgttgggtcaggt
gtcactgcagctccagctaaccaaaatgtcatcattcttcagccacccagcacaacccca
tgcccagcaatgatgagggcagaggtttccaaccaagcagtaggtcaacagattgtcatc
atacaggcggctaatcagaacccattgccactcctctctgctccccatcctggtcctgtt
cgactccctgtcaatggagccagtgctataatagggtctcataattcagtgcaaaatgtg
ccagccccacagacttttggaggaaagcatcttgtccatatattaccaagaccttcatct
ctgtccacatctaactcagcacagactttttctgttaccatgtcaaaccaacagcagccc
caaaccatttctttaaatggacagctctttgctttgcagcctgtgatgtcctcatcagga
actacaaatcaaagccctatgcaaatcattcaacccaccaccagcgaagatccaaatacc
aatgttgccctgaacacatttggggctttggccagcctcaatcaaagcatatcacagatg
gctggacaaagctgtgtacagttgtctattagccagtctgctaatcctcaaacttctgca
aacagtcaaactagccccactaactgtgtttcactaacaactgtagcacctaccatgaca
gcagaaaattcagccacgcagtccactacttatagccttgcaacagcttcctcaacaaac
accgtcacttgtttgccctctaccatgaaatcaaaaaggctgagcaagaagccaagtgcc
aagaaacacttagcagctaacaaaccagcatgtcccctgaattcagtcagagatgtgggc
aagatggatggccccggaatggacagctcagcagagccatcatgtagtgatggactgctg
aacggcctccctgttggcctgtcatctgtgactgtgtcccaggcaaagagtgttagtatt
tctgcttcacattctttggacattctgaattctgaatcagtgatccctgagtctgattcc
aaatctaaatcggcagaagactgtagctcatcctcccgagaatctgaagcaaatgaacaa
cttgcattggccacagcgaaatccaaagattctactcccattttgcaagagtcatctcag
ggtacaccaccatgctctgtagctctgcccaatgctacgaaatcctgtgcttcagccaat
gtgttgactccatctcctaccgaatccgagagtttggtttctcaggtttctggtatgcca
tccactacaagcacttcaaacactgtctgtatctctgaggtagaaattgtggcagaacct
tgcccggttcagcaggagtcattggacaccatgcaagcagcagggcctttaaaggggcaa
ggactaactatgttgctgtctgatcttgctaaagaaaaggaccttcagagaacatctctc
ccagtccagatggaccatcctgacttttctccagaaagttctaagataggtgatcctaat
gttgatttgcatcccaagcaggaactactactgacgagtgacgatagagatctgccacag
ccccactcctgtctccctgatcaggaggttattcatggctctttgctcaccagtaggcag
gctgactctcctatgtcaaccagctctggcagtagtcgtagtttctcggttgcctccatg
cttcccgaaacagctcgagaagatgtgaccagcagtacaactaacacatgtgacagttgc
acctttgcagagcaaactgacattgtggcccttgctgcaagagctattttagaccaggag
agcattgagaagggaaggcttggcacacaggctgatctgaaggatgttactccaaagcct
tctgaaacctctttagagggagaccagccctttaaaccacagatccacaaggagacttgc
acgggacaggcagatccaacaccaaatgaatttaactctcaggattcagtggaagtgaca
gttgataggcctcttgaaaagccaagctgttctctgggaattaaagcatcaaatccccca
ttacaggtgtcagcctctcagccaccgagtctcacccatcagaacagcatcagccgtcct
ctggtcagctgtgcgggtctatctcagagctcagatcaaactgctattcctgtgactgtt
aatatgactgttgcatccagtgcttatggcagccagcctcctgtgccacctctaatgaca
gaatattcccaggaacagctgaacagcatggctaactccataccaaatccacaggttcaa
gaaccgctttcaaagcctagtcatgaaagtcgtaaagattctgcaaagcgcactgtacaa
gatgatcttttactgtcttcggccaaacgtcaaaagcattgtcagccagcccctctcaga
cttgaaagtgtgcccctcatgagtcggactccagacaacattcctgatcaaactcaaatg
atggcgagtcagatcacgcccaactcctcaaactcagttgttcctgttagcaacccagca
catggagatggccttacacggttattcccagctggtaacaactttgcggctcctgtactg
aggcaggcagatgttcagtgtaaccctcagccttccgttgctgagcagccgcagcaaacc
caggcaggccaacatctgcaggcactgcagcagcatgtaccccctcaaggcgtgtctcac
cttcacaccaaccatctgtacctcaagcagcagcagcagcagcagcaagcagggcagcta
agggagaggcatcacttgtatcagctgcagcatcatgtgcctcatgcagataatgctgtc
cactcccagccccatatcgtgcaccaacagagaactctacagcaggaagttcagatgcag
aagaaaaggaatcttgttcagggcactcccacatctcagctatccttacaacccaaacac
catgggactgaccagtcgagacccaagagcagccaaccacatcctcaccatcaacagatg
cagcaacagctacaacaacactttgctagttcccagccagagaagagctgcgaaaaccct
tcaagtagccggggccaccacagccatccccagaaccatctcaatcaggacgttctacac
cagcaacaggatgttgggagcagacagcagggttcagcggtttcttctgatcatgtatct
gggcataatccaatgcagaggcttttaccatcaagaggcttagagcagcaaatggtgtcc
caaccaagtattgtgactaggtcttcagacatgacctgtgctccacacaggccagagaga
aaccgagtgtcaagttactctgctgaagcactcattggaaagtcatcttctacttcagaa
cagagactgggcatatcaattcagggttctagggtttcagatcagcttgagatgagaagc
tatcttgatgttcccagaaataagagcttggcacttcataatatgcagggtcgcatggat
catactgtcacctcagatatccgcctttctgattgtcagacattcaaaccaggggcagcc
agccaacagccccagagtaattttgaagtacaatcttcaagaaacaatgaaataggtaac
cctgcaccatcactgaggggtatgcagtcccaggcttttcgaattagtcaaaacactggc
ccaccaccaatagaccgacaaaagagattatcttatccgccagttcagagcatcccaaca
ggaaatgctgtcccaccaagggatagtgagaacacatgtcaccagagtttcatgcagagt
ctgcttgctcctcaccttggcgatcaggtcattgggagtcaaaggtcactctcagaacat
ccaaggaatacacaatgtggtccgtcttcaacaattgagtataattgtcctccagctcgt
gaaagtgttcatattagaagagagagtgaaagtcagaatagggagagttgtgacatgtct
ttaggtgcaattaaccccaggaacagcactttgaatattcctttctccagttcttcttcc
tcaggggatattcaaggtcgaaacacaagtcccaatgtttccgtacagaagtccaatccc
atgaggattactgacagtcatggggccaagggccacatgaaccctcctgtcacatccaac
atgcatggggttgcaaggccaactttgccacacccatctgtgtctcatgggaatgctgac
caagggcctcctgtgcgtcaggctaactcctcagttgcccagagatcaagacatcccctg
caggatagcagtggttctaaaatccgccagcctgaaaggaatcgttctggaaatcaaagg
cacagtaatgtctttgatccaagtcttcctcatcttcctctctccactagtggcagtatg
attcttggacggcaacagcctgctgcagagaagagaggaagtattgtccgcttcatgcct
gacagtccacaagtacctaatgataattcaggtcctgaccagcattcactgtcacaaaac
tttggttttccttttattcctgagggtggcatgaatccaccaataaatgctaatacttcc
ttcattccacaggtgactcagcctagtgccacccgagctccagctctcatcccagtagat
ccccagaacactctcccctccttctacccaccctactctcctgctcatcccactctgtcc
aatgacatctcaatcccttatttttctaatcaaatgttctccaatcctagcacagagaaa
gtgaacagtggaagtctaaacaaccgatttggatccattttatctcctcccagacctgtt
ggctttgctcagccaagtttccctcttctccccgagatgccgccaatgcacatggccaac
tctcacctatccaattttaatatgacgtcattgtttccggaaatagcggctcttcccgat
ggctcagcaatgtcacctttgcttaccatagcaaactcctctgcttctgactcttccaag
cagtcctcaaacagacctgctcacaacataagccatattttaggtcatgattgcagctca
gctgtttaa

DBGET integrated database retrieval system