KEGG   Rattus norvegicus (rat): 303948
Entry
303948            CDS       T01003                                 

Gene name
Nepro, RGD1311458
Definition
(RefSeq) nucleolus and neural progenitor protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4477 XPG_I_2
Other DBs
NCBI-GeneID: 303948
NCBI-ProteinID: NP_001009678
RGD: 1311458
Ensembl: ENSRNOG00000013721
UniProt: Q5I0D2
Position
11q21
AA seq 566 aa
MAAAVRPAAEPWNRVKIPQAGNCSTLTVQDPSATLDVCIAAVIKACHLVTRSLKSRTLDA
EVDVLCSVLYSNHNRLGHHRQHLALRQVEQCLKRLKHMNLEGSIEDLSQLLSANKTQPGA
TENRVVPSQPVMEVVLMKVLGGCKLLLRLLDRCCKTFLLTVKHLGLREFIILNLVMVGLV
SRLWVLHKGLLRRLISLYEPLLGLHQEISRIQPMPYFKDFAFPSNITDFLGSSYLDIFKG
KTPASFAPKGVTKLLNKLFLMKEQLSETNGDTLDKLSQPCEQMKSSPQSSVDLGQPVKAC
KRTRKEKPLGFDVRAFCTRLRNKATQETSQQFKYSQSKPKTTKLSSQKLRTHWANDTVQR
IRMTKTFTQLSEEIQMAIAWSRSKKLKAQAIYLGNKLLKTNRLRHVESQGYSLPKKLQCM
KTSLCKGLLRGFSVSTSKHPPRQRRSKYKVLSRQRKPQRKLQSTLIKETQQVPEGTLKTT
RDSSAKKRCSGGTVQRSDVCLNGEQVLSKLAKPDLKAKKMGVHGNLRGGGGSETGLRTKR
QVHMHSAPGTAQEADDIDDIFALMGV
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggccgcggccgtacggccagccgcggagccgtggaaccgcgtgaagatcccccaggcg
gggaactgcagcacactgacagtgcaggatcccagcgccaccctggatgtctgcattgca
gctgtcatcaaagcatgccacctcgtcacacggtcactcaagagccggaccttagatgcg
gaagtggacgtgctgtgctcagttctctacagcaatcacaacaggctgggccaccacagg
caacatttggccctcagacaggtagaacagtgcttaaaacgattgaaacacatgaatttg
gagggctccattgaagacctgtcacagttgttgtccgccaataaaactcagcctggagct
accgaaaaccgtgtggtgcccagccagccggtgatggaggtggtgctgatgaaggttttg
ggaggctgcaagttgttgctgcgcttgttggaccgctgctgcaagacgtttctgttgact
gtgaagcacttagggctacgcgagttcattattttgaaccttgtgatggttgggctggtg
agcaggttatgggttctccataaaggactcttgcgacggctgatttccttatatgagcca
ttgcttggattgcatcaggagatctccaggattcagcccatgccttacttcaaagatttt
gcctttccctccaacatcactgactttctaggctcctcttaccttgatatctttaaggga
aaaacccctgcatcttttgctcctaaaggagtaactaagctgctaaataaactgttttta
atgaaagagcaactatcagagaccaatggagacaccttggataaactttcccaaccatgt
gaacaaatgaaaagcagcccacagagcagcgtggacctggggcagccagtgaaagcgtgt
aaaaggacccgaaaagaaaagccattgggatttgacgtgcgggctttctgcacaagactc
cgaaacaaagctactcaggagaccagccaacagtttaaatattcccaatccaaaccgaag
acaaccaaactttcctctcagaaattgagaactcactgggctaatgatactgtgcaaaga
atccgaatgaccaagacattcacccaactttctgaagaaatccaaatggcaattgcgtgg
tcccggagcaaaaagctcaaggctcaggccatctatctgggcaacaaacttcttaagact
aataggcttagacatgtggaatctcaaggttacagtttgccgaagaagcttcagtgcatg
aaaacatctctttgcaagggccttctccgaggcttcagtgtcagcacttcaaagcaccct
cccagacaaagaagatcaaagtataaagttttatcaagacaaaggaaaccacagagaaag
ttacagtcaactcttataaaggaaacccagcaggtccctgaagggactctgaaaaccact
agggacagcagtgctaagaagagatgctctggtgggacagttcagaggtcagatgtctgt
ctgaatggagagcaggtcttgagcaaacttgcaaagcctgacctaaaagctaagaagatg
ggggtccatgggaatctgagagggggcggtggaagtgaaaccggcctgcggacgaagaga
caggtgcacatgcacagtgcgccaggcaccgctcaagaggcagatgacattgatgatatt
tttgctttgatgggagtttag

DBGET integrated database retrieval system