KEGG   Rattus norvegicus (rat): 304055Help
Entry
304055            CDS       T01003                                 

Gene name
C2cd2, RGD735112
Definition
(RefSeq) C2 calcium-dependent domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SMP_C2CD2L C2 DUF2057 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 304055
NCBI-ProteinID: NP_955423
RGD: 735112
Ensembl: ENSRNOG00000001621
UniProt: Q6P691
Position
11q12
AA seq 696 aa AA seqDB search
MGSWLGEVQWLFLVSLFVAALGTVGLYLAQWALAKARPPPRRRAEPDELRRQESDTLLSW
ILTRDSWGNQWLAAWVTALNYEAERSGGPLRLSFQKDPRPQSLQLTVGEVSSVVKSAQEK
MVICHVVGENLQFLVSAGPASTTGSECQLYDVQLSPFHLKVQFHMQEKREDIQITWSFTC
APETAIRIQPQAPGEKQVLEVNVLSEALKDLFKHLVSAASPSVFLSTKPMQAKEAQTLQC
TSSTAQEPCPPKPPRAHELKLQVKNIRVSLLNHPGASGISHMCVAQLNEPAQRFISTLVR
NTTDLSWEEEFTFELNAKSKELLLQISQEECSSEGLMGIATVHLDLFRKQPNGPQTFRLV
SGTEPESSVLGSVTAEFSYVEPGDLKSWPAPPLVSATKIEKDRTVMPCGTVVTTVTAVKT
KPRFDTGRASPLSSESPVRTPIKVKVIEKDISVQAISCHSAPVSKTLSSSDTELLVLNSS
DPVAEVAIRQLSESSKLKLKSPRKKSTIIISGISKTSLSQDHSAALMLNYAASMDSTNQG
EATSALCHPEATEASATTPPEENEPAQALPVLEPREDDLDSWDLEKESPVASWSGPVLQD
PDGDELSESSLSTSELGAIKKHKEGILRKGAKLFFRRRHHQKDPSLSQSHNDLVFLQQPE
GRQKKGATLSRLLNRKLLTRHRGKHTLNGPPREPCI
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgtggctcggcgaggtgcagtggctcttcctggtgtcgctcttcgtcgcggcc
ctgggcaccgtgggcctgtacttggcgcagtgggcgctggccaaggcgcgacccccgccc
cggcggcgggcggagccggatgagctaaggcgccaggagtcggacaccctcctttcctgg
atactgacacgggatagctgggggaaccagtggctggctgcctgggtgactgccctgaac
tacgaggctgaaaggagtgggggtccactgcgtctctctttccagaaggacccacggcca
cagtccttgcaactgacagttggggaggtatccagtgtggtcaagtcagcccaggagaag
atggtgatctgtcatgtggtgggcgagaatcttcagttcttggtcagtgcgggccctgcc
tctaccacaggctcagagtgccagctatatgatgtccagctttccccctttcatttaaag
gtgcagttccacatgcaagagaagagagaagacatccagatcacatggtcctttacctgt
gccccagaaacagccatcaggatccagccccaggccccaggggagaagcaggtgctggag
gtaaacgtgctttctgaagccctcaaggatcttttcaagcacctagttagtgctgcctcg
ccatctgttttcctgagcaccaagcccatgcaggccaaggaagctcagactctacagtgt
acttcctccactgctcaggaaccctgccctcccaaacctccaagggctcatgaactaaaa
ttgcaggtgaagaatatccgagtttccctgctaaaccaccctggtgcttcaggcattagc
catatgtgtgtggcccagctgaacgagcctgcacagcgattcatcagcaccctagtgaga
aacactactgacctcagctgggaggaggagttcacctttgaactgaatgccaaatccaag
gagctgctcctgcagatctcacaggaggagtgctcgtctgaaggtctgatggggatagca
accgttcacctggacttatttaggaagcagcctaatggcccacagaccttcagactggtc
agtgggacagagcctgaaagctcggtgttgggctcagtcactgcagagttttcgtatgta
gaacctggtgatctgaagtcctggccagctcctcccctcgtttctgctacaaagatagaa
aaggaccgtacagtgatgccatgtgggactgtggtcaccactgtcactgccgtgaagacc
aaacctcgctttgacactgggagggcatccccgttgagctcagagtcccctgtgaggaca
cctatcaaagtgaaggtcattgaaaaggacatctctgtccaggccatttcgtgccacagc
gccccagtcagcaagacactctcctcttctgacacggaactgttggtactgaacagctca
gatcctgtggctgaagttgccattcggcagctcagcgagtcctcaaagctgaaactgaag
tccccacggaagaaaagcaccatcataatttcagggatctccaagacctcactatctcag
gaccacagtgctgccctcatgctgaactatgcagcttctatggacagcaccaaccaggga
gaggccacttctgctttgtgccatccagaggcaactgaagcctctgccaccaccccacct
gaagaaaatgagccagcccaagccctaccagtcctcgagcccagagaggatgatttagat
tcctgggacctggagaaggagtctccggtagcatcgtggagcggtccagtcttgcaggat
cctgatggggacgaactgtcagagagctccctgagtacttcagagctaggagccatcaag
aagcataaagaaggaatcctaaggaaaggtgccaagctcttcttccgccggcgacaccat
cagaaagacccaagcttgagccagtcgcataacgacctggtattcctgcagcagccagag
gggaggcagaagaaaggggcgaccctcagccggctcctgaacagaaagctgcttaccagg
cacagaggcaaacacaccctcaatggaccacccagagagccctgcatatag

DBGET integrated database retrieval system