KEGG   Rattus norvegicus (rat): 304078
Entry
304078            CDS       T01003                                 

Gene name
Cbr3
Definition
(RefSeq) carbonyl reductase 3
  KO
K00084  carbonyl reductase 3 [EC:1.1.1.184]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    304078 (Cbr3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    304078 (Cbr3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     304078 (Cbr3)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 304078
NCBI-ProteinID: NP_001100580
RGD: 1309728
Ensembl: ENSRNOG00000001701
Vega: OTTRNOG00000000874
UniProt: B2GV72
Position
11q11
AA seq 277 aa
MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFH
QLDIDNPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDVQAEVTLKTNFFATRN
VCTELLPIMKPHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTK
NEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG
SRTVEEGAETPVYLALLPPDATEPHGQLVRDKVVQTW
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtcgtcctgcagccgcgtggccctggtgactggggctaacaaaggcatcggcttcgcg
atcacgcgtgacctgtgtcggaaattctcgggggacgtggtgctcacggcgcgggacgag
gcgcggggccgcgcagcggtgaagcagctgcaggcggagggcctgagcccacgcttccac
cagctggacatcgacaacccgcagagcatccgcgcgctgcgcgactttctgcgcaaggag
tacggaggacttaacgtgctggtcaacaatgcgggcatcgcctttagaatggatgatcca
acgcccttcgacgttcaagctgaggtgacactgaagacgaacttctttgccactagaaat
gtctgcaccgagctgctgcccataatgaaaccacatggtagagtggtgaatgtcagcagt
ctgcaggggttaaaagcccttgaaaactgcagcgaagatcttcaggaaaggttccgatgt
gacacacttaccgagggggatctggtcgacctcatgaaaaagtttgtggaggacacaaaa
aatgaagtccacgagagagaaggttggccagactcagcttacggggtgtccaagctgggc
gtgacagtccttacgagaatcctggcccggcagctggacgagaagaggaaagcggacagg
attttgctgaatgcctgctgcccgggatgggtgaagaccgacatggcgagggaccagggc
tccaggaccgtggaagagggggcagaaacccccgtttacttggccctcctgcctccagat
gccactgagcctcatggccagctcgtccgtgacaaagttgtgcaaacgtggtga

DBGET integrated database retrieval system