KEGG   Rattus norvegicus (rat): 304103Help
Entry
304103            CDS       T01003                                 

Gene name
Olig2
Definition
(RefSeq) oligodendrocyte lineage transcription factor 2
  KO
K09085  class B basic helix-loop-helix protein 1/6/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    304103 (Olig2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    304103 (Olig2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH CCDC106 UBN_AB DUF508
Motif
Other DBs
NCBI-GeneID: 304103
NCBI-ProteinID: NP_001094027
RGD: 1307098
Ensembl: ENSRNOG00000028658
UniProt: G3V612
Position
11q11
AA seq 323 aa AA seqDB search
MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMG
TAGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSTPLPTATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGTLPRLTSDAK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacgccagcctggtgtctagtcgcccgtcgtcgccagaacccgatgatctt
tttctgccggcccggagcaaggggggaagcagcagcggcttcacaggaggaaccgtgtcc
tcatccacgccgagcgactgcccgccagagctgagctccgagctgcgaggagccatgggc
acggcgggcgcgcatcccggggacaaactgggcggcggtggcttcaagtcatcttcctcc
agcacctcctcgtccacgtcgtcggcggccacgtcttccaccaagaaagataagaagcag
atgactgagcccgagctgcagcagctgcgcctgaagatcaacagccgcgagcgcaagcgc
atgcacgacctcaacatcgccatggacggcctgagggaggtcatgccgtacgcgcacggc
ccgtcggtgcgcaagctctccaagatcgccacgctgctgctggcgcgaaactacatcctg
atgctcaccaactcgctggaggagatgaagagactggtgagcgagatttacgggggtcac
cacgccggcttccacccgtcggcctgtggcgggctggcacactcgacgcctctacccacc
gccacggcgcaccctgcagccgccgcgcacgccgcgcaccacccggcggtgcatcacccc
atcctccctccagcagccgcggccgcagccgccgcagccgctgccgcagcggtgtccagc
gcttctctgccgggctccgggctgtcctcggtcggatccatccggcctcctcacggcctg
ctcaagtctccatcggcagccgcggccgcccctctcggaggcgggggtggaggcagcggt
ggcagcggtggcttccagcactggggtggcatgccgtgcccctgcagcatgtgccaggtg
ccgccgccacaccaccacgtgtcggctatgggcgccggcaccttgccgcgcctcacctcc
gacgccaagtga

DBGET integrated database retrieval system