KEGG   Rattus norvegicus (rat): 304109
Entry
304109            CDS       T01003                                 

Gene name
Tiam1
Definition
(RefSeq) T-lymphoma invasion and metastasis-inducing protein 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    304109 (Tiam1)
   04015 Rap1 signaling pathway
    304109 (Tiam1)
   04024 cAMP signaling pathway
    304109 (Tiam1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    304109 (Tiam1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    304109 (Tiam1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    304109 (Tiam1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    304109 (Tiam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    304109 (Tiam1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   304109 (Tiam1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_6 PDZ_2 PH_11
Other DBs
NCBI-GeneID: 304109
NCBI-ProteinID: NP_001094028
RGD: 1307455
Ensembl: ENSRNOG00000021569
Position
11
AA seq 1590 aa
MGNAESQNVDHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKAIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALDDFGDPIWVDRVDMGLRPVSYTDSSVTPSVDGSIVLTA
ASVQSMPDSEESRLYGDDAAYLAEGGRRQRPYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETGASPRQLSTCQRANSLGDLYAQKN
SGVKANGGPRNRFSSYCRNLVSDIPDLAKHKMPPAAVETPTYSNYNTLPCRKSHCLSEGA
TNPQISLSKSMQGRRAKTTQDVNTGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPPT
GRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSPG
QSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDG
RSGIDHNSVPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITA
IHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDAKKKKTIL
DQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLGFASRPTKVAMGRLGIFSVSS
FHALVAARTGEIGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPTINQVFGEGTD
AVKRSLEGIFDDSVPDGKREKEVVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTVV
RPGDTARDTLELICKAHQLDHSAHYLRLKFLMENKMQFYVPQPEEDIYELLYKEIEICPK
VTQNIHIEKSDAAADNYGFLLSSVDEDGVRRLYVNSVKETGLASKKGLKAGDEILQINNR
AAGTLNSSMLKDFLSQPSLGLLVRTYPEPEGGVELLENPPHRVDGPVDLGESPLTFLTSN
PGHSLSSEQGSSAETAPEEGEGPDLESSDETDHSSKSTEQVTAFCRSLHEMSPSDSSPSP
QDATSPQLATTRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDEL
DVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKL
YSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLLR
ELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVAD
LSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLS
IYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSPE
SRKDFLKSVHSILRDKHRRQLLKTESLPSAQQYVPFGGKRLCALKGARPAMSRAVSAPSK
SLGRRRRRLARNRFTIDSDAISASSPEKEPQQPPGGGDTDRWVEEQFDLAQYEEQDDIKE
TDILSDDDEFCESAKGASVDIDLQEQLQAASISQRARGRKTLDSHASRMTQLKKQAALSG
INGGLESASEEVIWVRREDFAPSRKLNTEI
NT seq 4773 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagccaaaatgtagaccacgagttttatggagaaaagcatgccagc
ctggggcggaagcacacatcacgctccctgcgactgtcacacaagacccggaggacgcgg
catgcttcctctgggaaggcaatccacaggaactctgaagtgagcacgcggtccagcagc
acccctagcatcccccagtccctggccgaaaatggcttggagcccttttcccaagaaggc
gccctagacgacttcggggaccccatctgggtggaccgagtggatatgggcttgagaccc
gtgtcttacacggattcttctgtcactcccagcgtagacggcagcatcgtcctcacggca
gcctctgtgcagagcatgccagactcggaggagagccggctttacggggatgacgctgcg
tacttggctgagggaggcaggaggcagcgtccctatacatccaacgggcccacgttcatg
gagacagcgagctttaagaagaaacgctctaaatctgcagacatctggcgggaggacagc
ctggagttctcactctcagatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggctccgcggaagagaaggattgcgaggaggctcgggggatggaaacaggggcgagcccc
cggcagctcagcacctgtcagcgagccaactccctgggtgacttgtatgctcagaagaac
tccggggtgaaggctaacggaggaccgagaaacagattttcgagctactgccggaatttg
gtgtcggatattcccgatcttgcaaagcataagatgccaccggctgctgtagagactccg
acgtacagtaattataacacgcttccctgtaggaagtcgcactgtctttccgagggtgcc
accaacccacaaattagccttagcaagagcatgcaaggcagaagagcgaaaaccacccag
gatgttaacacaggcgagggcagtgagtttgcagacagtgggatcgaaggggccaccacg
gacacggacctcctgtccaggagatccaatgccaccaactccagctactcgcctcccaca
ggccgagcctttgtgggcagcgacagcggcagcagttcgactggggatgctgcacgccag
ggggtgtacgagaacttcaggcgggaactggagatgagcaccaccaacagcgagagcctg
gaggaggctggctctgcgcacagcgacgagcagagcagcggaaccctcagctccccgggc
cagtcggacatcctgctgacggctgcgcagggcactgtgcggaaggctggcgcgctggca
gtcaagaacttcctggtacataagaagaataagaaggtggagtcggctacccggaggaag
tggaagcactactgggtgtccctgaaaggttgcacgctctttttctacgagagtgatggc
aggtctgggatagaccacaacagtgtccccaagcatgctgtctgggtggagaacagcatc
gtgcaggccgtacctgagcaccccaagaaagattttgtcttctgcctcagcaactccctg
ggcgatgccttcctcttccagaccaccagccagacagagctggagaactggatcacggcc
atccactctgcctgcgcagctgcggtcgcaaggcaccaccacaaggaagacacgctccgc
ctcctcaagtcggaaatcaagaagctggagcaaaagattgacatggacgagaaaatgaag
aagatgggcgagatgcagctgtcctccgtcacggacgcgaagaagaagaagaccatactt
gaccagatcttcgtttgggagcagaacctcgaacagttccagatggaccttttccggttc
cgctgttaccttgccagcctccagggcggggagctgccaaaccccaaacgactcctaggt
tttgccagccggcccaccaaggtggccatgggccgccttggcatcttttcggtatcatct
tttcacgccctggtggcggcccgcactggcgagatcggggtgagaaggcgtactcaggct
atgtccaggtctgcgagcaagcggaggagcaggttttcttctctctggggcctagacact
acctccaaaaagaagcaggggcgcccaaccatcaaccaggtgtttggagaggggaccgat
gctgtaaagagatctttagagggaatatttgatgactctgttccagacggcaagagggag
aaggaagtggtcttacccagtgtccaccagcacaatcctgactgtgacatttgggtccat
gaatatttcactccatcctggttctgtctacccaataatcagccagccttgacggttgtc
cggccgggggacactgcgagggacaccttggagctcatttgcaaggcgcaccaactggat
cattctgcccattacctgcgcctgaaatttctgatggagaacaagatgcagttctatgtc
ccgcaacccgaggaggacatttacgagctgctttacaaagaaatcgaaatctgtccgaaa
gtcacccagaacatccacattgagaagtccgacgcggccgccgataattacgggtttttg
ctttcttctgtggacgaagatggcgttcgaaggctctacgtgaacagcgtcaaggaaacc
gggctagcttccaagaaaggcctgaaggcgggggacgagattcttcagatcaataaccgt
gccgctggtaccctgaactcatctatgctcaaagatttcctctcacagccctctctgggc
ctcctggtgaggacctaccctgagccagagggaggagtggagctgctagagaacccaccc
caccgagtggacggccctgtggaccttggcgagagccccctcaccttcctcaccagcaac
ccagggcacagcctctccagcgagcagggcagcagtgctgagacagctccggaagagggc
gaaggaccggacttggagtcttccgatgagacagatcacagcagcaagagcacagaacag
gtcacagcgttttgccggagtctgcacgagatgagcccctctgactcgagcccgtcccct
caggatgccacgagccctcagctggcaaccacacgacagctatcggacgcagataaactg
cgcaaggtgatctgtgagctcctagagaccgaacgcacctatgtgaaggacttaaactgc
ctcatggagagatacctgaagccccttcagaaggagacctttctcacccaggatgagctc
gatgtactctttggaaatttaaccgaaatggtggagtttcaagttgagttccttaaaact
ctagaagatggagttagactggtccctgacttggaaaagcttgagaaggttgaccagttt
aagaaagtgctgttctctctggggggatccttcctgtactacgcggaccgcttcaagctc
tacagtgccttctgtgcgagccatacgaaagtccccaaggtcctggtgaaagccaagacg
gacacagccttcaaggcattcctagatgcccagaacccgaggcagcagcactcgtccaca
ctagagtcttacctcatcaagcccatccagagggtcctcaagtacccgcttctgctcagg
gagctgtttgcgctgaccgacgcggagagtgaggagcattaccacctggatgtggccatc
aagactatgaacaaggttgccagtcacatcaatgagatgcagaagatccacgaagaattt
ggtgctgtgttcgaccagctgattgctgagcagacaggagagaagaaagaggtcgcggat
ctgagcatgggtgacctgctgttgcacaccagtgtcatctggctgaacccacccgcctcg
ctgggaaagtggaaaaaggagccggaactggcagccttcgtcttcaaaactgccgtggtc
cttgtgtataaagatggttccaagcagaagaagaagctcgttggctctcacaggctgtca
atctacgaggagtgggaccctttccggtttcgccacatgatccctaccgaagctttgcaa
gtccgagctctgcccagtgcagatgcagaggcaaatgccgtgtgtgaaattgtccacgtg
aaatcagagtcagaggggaggccggagcgggttttccacctctgctgcagctccccggag
agccgaaaggattttctgaagtctgtacactccatcctgcgagataagcacagaaggcag
ctcctcaaaacggaaagtcttccctcagcccagcagtatgtcccttttggaggcaagaga
ttgtgtgcgcttaaaggcgccaggccagccatgagcagggcagtgtctgccccaagcaag
tctcttgggaggaggaggcggcgactggcccgaaacaggtttaccattgattcagacgcc
atctcagccagcagcccggagaaagagccccagcagccccccggtggcggggacactgac
cgatgggtagaggaacagtttgatcttgctcagtatgaggagcaggatgacatcaaggag
acagacatcctcagtgacgatgatgaattctgtgagtctgcgaagggcgcctcagtggac
atagacctgcaggagcagcttcaggctgcctctatcagtcagcgcgcccgaggccggaaa
acccttgatagccacgcctcccgcatgacacagctcaagaagcaagcggccctttcgggc
atcaacggaggcctggagagtgcgagcgaggaggtcatttgggttaggcgcgaagacttt
gccccctccaggaaactgaacacagagatatga

DBGET integrated database retrieval system