KEGG   Rattus norvegicus (rat): 304150
Entry
304150            CDS       T01003                                 

Gene name
Usp25
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 25
  KO
K11849  ubiquitin carboxyl-terminal hydrolase 25 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    304150 (Usp25)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    304150 (Usp25)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    304150 (Usp25)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     304150 (Usp25)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   304150 (Usp25)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    304150 (Usp25)
SSDB
Motif
Pfam: UCH UIM UBA_4
Other DBs
NCBI-GeneID: 304150
NCBI-ProteinID: NP_001100584
RGD: 1309003
Ensembl: ENSRNOG00000001573
UniProt: D4ACD3
Position
11
AA seq 1055 aa
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDAQILQQALKDSNGNLELAVAFLTAKNAK
TPPQEETAYYQTAALPGSDRYISVGSQADANVIDLTGDDKDDLQRAIALSLAESNRTFRE
TGITDEEQAISRVLEASIAENKACLKRTPIEVWRDSRNPYDRKRQDKAPVGLKNVGNTCW
FSAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKY
VDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELF
YGRFLAMGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSDNSGKSGQ
EHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEI
KRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDATSSTS
GSTSSQSLPSTTEQQGTPASDLPSSSPASGAALSLRSVIHKPFTQSRIPPDLPMHPAPRH
ITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVH
EGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKA
QFLIQEEFNKETGQALVGMETLPPDLRDFVEEDNQRFEKELEDWDTQLAQRALQEKLLAA
QKLREAESSAPTAQAGGPDYLEQPSRSDLSKHWKEETLRVIAKASHDHEDKGPETVLQSA
IKLEYSRLVKLAQEDTPPETDYRLHHVLVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERC
HNIMKVAQAKLEMIKPEEVNLEEYEEWHADYKKFRETTMYLIIGLENFQRESYIDSLLFL
ICAYQNNKELLSKGPYRGHDGDLISHYRRECLLKLNEQAAELFESGEDREVSNGLIIMNE
FIVPFLPLLLVDETEERDILAVEDMRNRWCSYLGQDMEPNLQEKLTDFLPKLLDCSTEIK
GFHEPPKLPSYSAHELCERFARIMLSLSRTPADGR
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgaccgtggagcagaatgtgctgcagcagagcgcggcgcagaagcaccagcagacattt
ctgaatcagctgagagaaataactgggatcaatgacgcccagatactgcagcaagccctg
aaggatagtaatggaaacttggaattagcagtggccttcctcactgcaaagaatgccaag
acccccccgcaggaggagacggcctattaccagacagcagcacttccgggcagcgacagg
tacatcagcgtggggagccaggcagatgcgaatgtgattgatctcactggagacgacaaa
gatgatcttcagagagcgattgctttgagtttggcggaatcaaacaggacgttcagggaa
actggcataaccgatgaggaacaagccatcagcagagttcttgaagccagcatagcagaa
aataaagcatgtttgaagagaacacctatagaagtttggagggattctcgaaacccttat
gaccggaaaagacaagataaggctccggttgggctgaagaacgttggcaacacctgctgg
tttagcgcagttattcagtcattattcaatcttttggaatttagaagattagttctgaat
tacaagcctccatcaaatgctcaagatttaccccgaaaccaaaaggaacatcggaatttg
ccttttatgcgggaattgaggtatctgtttgcacttcttgttggtacgaagaggaaatat
gttgatccatccagagcagttgagattctaaaggatgccttcaaatcaaatgactcacag
cagcaagatgtgagtgagtttacacacaagttattggattggctggaagatgccttccaa
atgaaagctgaagaggaaacggatgaagagaagccaaagaaccctatggtagagttgttc
tacggaagattcctagccatgggagtgcttgaaggaaaaaaatttgaaaacactgaaatg
tttggtcagtatccgctccaggtcaatgggttcaaagacctacatgagtgcctggaagct
gcaatgatcgaaggagagatcgagtccttacactcggataattcaggaaaatcgggccaa
gagcattggttcactgaattgccacctgtattaacatttgaactgtcaagatttgaattt
aatcaggcattgggaagaccagaaaaaattcacaataaactagaatttccccaagtttta
tacctggacaggtatatgcacagaaacagagaaataacaagaattaaacgtgaagagatc
aagagacttaaagattacctcacagtattacaacaaagattagagagatatttaagctat
ggctccggtcccaaaagattcccactggtcgatgttctacagtatgcgttggagttcgcc
tccagtaagcctgtctgcacctctcctgtggatgatatcgatgctacttcctcaaccagt
ggctccacatcatcacagtcgttaccaagcacaacagaacagcagggaacccctgcttca
gacctgcccagctcgtcacctgcatcaggtgctgccctgtcactgaggtcagtgatacac
aaacccttcactcagtcgcggatccctccagacttgcccatgcatccggcaccaaggcac
atcacagaggaagaactgtctgtgctggagagctgtttacatcgctggaggacggaaata
gaaaatgacacacgagacctgcaggaaagcatatctagaatccatcgaacaatcgaactg
atgtactcggacaaatccatgatccaggtcccttaccgcctccatgctgtcttagttcat
gagggccaggctaatgccggccactactgggcgtacatctttgaccatcgtgagagcagg
tggatgaagtacaatgatattgctgtgaccaagtcatcatgggaagaactagtgagggac
tcttttggtggttatagaaatgccagtgcatactgcttaatgtacataaatgacaaggca
cagttcttaatacaagaggagttcaataaagagactgggcaggcccttgttggaatggaa
acattacctccagacttgagggattttgtggaggaagacaaccagcgcttcgagaaggag
ctggaagactgggacacacagctcgcccaacgagcactgcaagaaaagctgctggctgct
cagaagctgcgggaagcagagtcttctgcgcccacagcacaagcaggaggaccagactat
ctagagcagccatcaaggagtgacttgtcaaaacactggaaagaagaaactctccgagtg
attgccaaggcatcacatgatcacgaagataaagggccagagacagttttgcagtcggca
ataaaattagagtattcaaggctggtcaagttggcccaagaagataccccaccagaaaca
gattatcgtttacatcatgtcctggtctactttatccagaaccaggcaccaaagaaaatc
attgagaaaacattactcgaacaatttggagatagaaatttgagttttgatgaaaggtgt
cacaacataatgaaagttgcccaagccaaactggaaatgatcaaacctgaagaagtgaac
ttggaggaatatgaggagtggcacgcagattataagaaattcagagaaacaactatgtat
ctcataattggactagaaaactttcagagagaaagttatatagactccttgctgttcctt
atctgtgcttatcagaataacaaagagctcttgtccaagggtccatacagagggcatgat
ggagacttgatatcacattacagaagagagtgtttactgaaattaaatgagcaagcggca
gagctgttcgagtctggagaggaccgagaagtgagcaatggcttaattattatgaatgag
tttatcgttccctttttgcccttgttgctggtggatgaaacggaagagagagatatcctt
gctgtggaggacatgaggaaccgatggtgttcatacctggggcaagacatggaacccaac
ctccaagaaaagctgacggattttctgccaaaactgcttgattgttctacagagattaaa
ggtttccacgagccgccaaagttaccttcctattctgcgcatgaactctgcgagcgattc
gcccgaatcatgttgtccctcagtcgcactcctgctgatggaagataa

DBGET integrated database retrieval system