KEGG   Rattus norvegicus (rat): 304157
Entry
304157            CDS       T01003                                 

Gene name
Nrip1, RIP140
Definition
(RefSeq) nuclear receptor interacting protein 1
  KO
K17965  nuclear receptor-interacting protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    304157 (Nrip1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    304157 (Nrip1)
SSDB
Motif
Pfam: NRIP1_repr_4 NRIP1_repr_1 NRIP1_repr_2 NRIP1_repr_3
Other DBs
NCBI-GeneID: 304157
NCBI-ProteinID: NP_001094030
RGD: 1311850
Ensembl: ENSRNOG00000001585
UniProt: G3V672
Position
11p11
AA seq 1162 aa
MTHGEELGSDVHPDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHSEEDQNFNLSGSAFPT
CQSNGPTLSTQTYQGSGMLHLKKARLLQSSEDWNAAQRKRLSDSIVNLNVKKEALLVGMV
DSVPKGKQDSTVLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHESLKVEKDLRCYGV
ASSHLKTLLKKSKTKDQKSGTTLPDVTPNLIRDSFVESSPHHVGQSGTKVMSEPLSCAAR
LQAVASMVEKRASPAASPKPSVACSQLALLLSSEAHLQQYSREHALKTQSAHQAASERLA
AMARLQENGQKDMSSFQLSKGVSGHLDGQARTLPQSSKLAASKNNAAVFQNPMCGVPSSP
KNTSYKNSLERNNIKQAANNSLLLHLLKSQTIPTPMNGHSQHERGSSFESSTPTTIDEYS
DNNPSFTDDSSGDESSYSNCVPIDLSCKHRTEKPETERPVSLENLTQSLLNTWDPKVPGV
DIKEDQDTSTNSKLNSHQKVTLLQLLLGHKTEESVERNASPQEVHSDVTKFSPQNYTRTS
VIESPSTNRTTPVSTPPLHTSSQGESPINLSQHSLVIKWNSPPYACSTPASKLTNTVTGH
LMDLTKGKESQAEKPAPSEGAQNSATFSASKLLQNLAQCGMQSSVPGEEQRPSKQLLSGH
TDKPLGLIDRLNSPLLSNKANAAEENKAFSSQPAGPEPGLPGCEIENLLERRTVLQLLLG
NSNKGKSEKKERAPALDEARQEHSERPGNEQILMVKIKSEPCDDFQTHNTNVHLNHDAKS
TPFLGGTPTIQRSSAALPVSEDLKSEPASPQDFSFSKNGLLSRLLRQNQESYPADDQDKS
HRNSELTPLESKNFCMVPKKRKLYTEPLENPFKKMKNSAVDNANNHGGPEVLYGSLLNQE
ELKFSRNDLDYKYSAGHSSASDGEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVT
DNKKKGHKNNVPNSKPEFSISSLNGLMYGSPQPGSCVDHRTFSYPGMVKTPLSSPFPEHL
GCVGSRPEPGLLNGCSVPVPGEKGPIKWVITDVEKNEYEKDSPRLTKTNPILYYMLQKGG
NSVTTQETQDKDIWGEPSSAESLSQVTVKEEMLPAAETKAAFFNLRSPYNSHMGNNASRP
HSTNGEAYGPLGNVLTIKKECE
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgactcatggagaagagcttggctctgatgtgcatccggattctattgttttaacttac
ctagaaggattactaatgcatcaggcagcagggggatcaggtactgccgtcgacaaaaag
tctgctggccacagcgaagaagaccagaactttaacctctctggcagtgcctttcccacc
tgtcaaagcaatggtcccactctcagtacacagacataccagggatctggcatgctgcac
ctcaaaaaagccagactgctgcagtcttctgaggactggaacgcggctcagcggaagagg
ctgtccgattccatcgtgaatttaaacgtaaagaaggaggctttgctggttggcatggtt
gacagtgtgcctaaaggcaaacaggatagcacagtactggcctctttgctccagtcattc
agctccaggctgcagactgttgctctgtcacagcagattagacagagcctcaaggagcaa
ggatatgccctcagccacgagtcgttgaaagtggagaaggatttaaggtgctacggcgtg
gcctcaagtcacttaaaaactctgctgaagaaaagtaaaactaaggatcagaagtcaggt
accaccctccctgatgtgactccgaaccttatcagagatagctttgttgagtcatcacct
catcatgtcggacaaagtggaacaaaggtcatgagtgagcccttgtcatgtgctgcaaga
ttacaggctgttgccagcatggtggagaaaagggctagtcccgccgcctcccccaagccc
agtgttgcctgcagccagctagcgctgctcctttccagtgaggcccacctgcagcagtac
tctcgggaacacgctctcaaaacacagagtgcacatcaggcagcaagtgaaaggctcgcc
gccatggccagattgcaggagaacggtcagaaggacatgagcagtttccagctctctaag
ggggtgtctggccatctcgacgggcaggccagaacactgccacagtcaagcaaactggcg
gctagcaagaataacgcagcagtctttcagaatccaatgtgcggtgttccttcctctccc
aaaaacacaagctataagaactctctggaaagaaacaacataaagcaagccgctaataac
agtttgcttttacatcttctcaaaagccagaccatccccacgccgatgaacgggcacagc
cagcacgagagaggaagtagttttgagagtagcacacccaccacgatcgatgagtactct
gataacaatcctagcttcacagatgacagcagtggggatgaaagctcatactccaattgc
gttcccatagacctgtcctgcaaacaccggaccgagaaaccggaaaccgagcgtcccgtt
tctcttgagaacctaacccagtccttgttaaacacgtgggatcccaaagtgcccggtgtt
gacatcaaagaagatcaagatacctcaacaaattccaagctgaattcacaccagaaagtc
actcttcttcaattgctgcttggccataaaactgaggaaagtgttgaaaggaatgccagc
cctcaggaagtccacagcgatgtgactaagttcagtcctcagaattacacaaggacttca
gtcattgagagccccagcaccaacaggactaccccagtgagcactccaccgctgcacacg
tccagtcaaggagaatctcccatcaatctttctcaacactctctggtcatcaagtggaat
tccccgccatatgcctgcagtactcccgcttcaaaactaacaaataccgtgactggccac
ctgatggacctcacaaaaggcaaagaatcacaagcagagaaaccagccccgagtgaaggt
gcacaaaattcggcgacgttcagcgccagcaaactgttacagaatttggctcagtgcgga
atgcagtcttccgtgccaggggaagagcagagacccagcaaacagctgttaagtggacac
acagacaaacctctcggtctgatcgataggttaaatagccctctgctctcaaataaagca
aatgcagctgaagaaaacaaagccttcagcagtcagcctgcagggcctgaaccaggactt
cctggttgtgagatagaaaacctactggaaagacgcactgtccttcagttgctcctggga
aattccaacaaagggaagagtgagaagaaagagagagctcccgcactggacgaggctcgt
caggagcattcggagagacccggaaatgaacagatactgatggtgaaaattaaatctgag
ccctgtgatgacttccagacccacaacacaaacgtgcatttaaaccacgatgccaagagc
accccgttcttaggcgggactcccaccatccagaggagctcggcggccttaccagtgtca
gaggacttgaaatcagagcctgcttcacctcaggatttttctttctcaaagaacggtctg
ttaagtcgactgctgagacagaatcaagagagttacccagcagatgatcaggacaagagt
cacagaaacagtgagctgacacccctggaatccaagaacttttgcatggtccctaaaaaa
aggaagctttatacggaaccactagaaaacccatttaaaaagatgaaaaatagtgccgta
gataatgccaataatcatggtggccccgaagtactctatgggtcgctgcttaatcaggag
gagctgaaatttagcagaaatgatctcgactataaatactctgctggtcacagttcagcc
agcgatggtgaacataggagttgggccagagagagcaaaagcttcaacgttcttaagcag
ctgcttctctcagagaactgtgtgcgagatttgtccccacacaggagtaactctgtcacc
gacaataaaaagaaaggacacaaaaacaacgtgcccaatagcaaacctgaattcagcatt
tcttctttaaatggactgatgtatggttcccctcagcctggcagttgtgtggatcatagg
acattttcatacccaggaatggtaaaaacccctctgagctctcctttcccagagcacttg
ggctgtgtagggtccaggccagaacctgggcttttgaatggctgttctgtgcccgtgccc
ggtgagaagggacccattaagtgggtcatcacagatgtggagaagaatgagtatgaaaaa
gactctccgagactgaccaaaaccaacccaatcctctattacatgctccagaaaggaggc
aactctgttaccacacaagaaacacaggacaaagacatctggggggagccttcatctgcc
gagagtctctcacaggttacagtcaaggaagagatgcttcctgccgcagaaactaaagct
gctttcttcaatctcagaagcccttacaacagccatatgggaaataatgcttcccgcccg
cacagtacaaacggagaagcgtatggacccctgggaaacgtgctcaccataaaaaaagag
tgcgagtga

DBGET integrated database retrieval system