KEGG   Rattus norvegicus (rat): 304181
Entry
304181            CDS       T01003                                 

Gene name
Tssk2, Stk22b
Definition
(RefSeq) testis-specific serine kinase 2
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    304181 (Tssk2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    304181 (Tssk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     304181 (Tssk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   304181 (Tssk2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    304181 (Tssk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 304181
NCBI-ProteinID: NP_001012019
RGD: 1304951
UniProt: Q6VAH7
Position
11q23
AA seq 358 aa
MDDAAVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPRE
MDILATVNHRSIIKTYEIFETSDGRIYIVMELGVQGDLLEFIKCRGALHEDVARKMFRQL
SSAVKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDGSGRIVLSKTFCGSAA
YAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSDIKKMLRIQKEHRVDFPRSKN
LTGECKDLIYRILQPDVNRRLHIDEILSHSWLQPPKPKAMSSASFKREGEGKYRADCKLD
TRPGSRPEHRPDHKLGSKPQHRLLVAPENEDRMEERLAETSRAKDHHISGAEVGKAST
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggacgatgccgcggtcctaaggaagaagggttacatcgtgggaatcaatctgggcaag
ggctcctatgcaaaagtcaaatctgcctactcagagcgcctcaagttcaatgtggcagtc
aagatcatagaccgcaagaaaacacccactgactttgtggagagattccttcctagggag
atggacatcctggcgactgtcaaccaccgttccatcattaagacctatgagatctttgag
acctctgatggacgcatctacattgtcatggagctgggcgtccagggcgacctcctcgag
ttcatcaagtgccgaggagccctgcacgaggatgtggcacgcaagatgttccgccagctc
tcctcagccgtcaagtactgccatgatctggatgtcgtccaccgagacctcaagtgtgag
aaccttctgcttgacaaggacttcaacatcaagctgtctgacttcggcttctccaagcgc
tgcctgcgggacgggagcgggcgcatcgtcctcagcaaaaccttctgtgggtcagcagct
tatgcggcccccgaggtgctgcagggcatcccctaccagcccaaggtgtatgacatctgg
agcctgggtgtgatcctctacatcatggtctgtggctccatgccctacgatgactctgac
atcaaaaagatgctgcgcatccagaaggagcaccgagtggacttcccacgctccaagaat
ctaactggtgagtgcaaggacctcatctaccgcatcctacagccagatgtcaaccggagg
ctgcacattgatgagatcctcagccactcgtggcttcagccccccaagcccaaagccatg
tcttctgcctccttcaagagggagggggaaggcaagtatcgagctgattgcaagttggat
actcgaccaggctcaagacccgaacaccggcctgaccacaaactggggagcaaaccccag
caccggctgctggtagcacctgagaatgaagacaggatggaggagaggctggcggagact
tccagagctaaagaccatcacatctctggagctgaggtggggaaagcaagtacctag

DBGET integrated database retrieval system