KEGG   Rattus norvegicus (rat): 304289
Entry
304289            CDS       T01003                                 

Gene name
Daglb, RGD1310193
Definition
(RefSeq) diacylglycerol lipase, beta
  KO
K13806  sn1-specific diacylglycerol lipase [EC:3.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04723  Retrograde endocannabinoid signaling
rno04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    304289 (Daglb)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    304289 (Daglb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     304289 (Daglb)
SSDB
Motif
Pfam: Lipase_3 Abhydrolase_3 Abhydrolase_6
Other DBs
NCBI-GeneID: 304289
NCBI-ProteinID: NP_001100590
RGD: 1310193
Ensembl: ENSRNOG00000001079
Position
12p11
AA seq 668 aa
MPGMVLFGRRWSLASDDLVFPGSFELFLRVLWWIASLTLYLMHRRKLDCPGGVLLSTYLI
VLLVLLAVIIGIVLAIVCVSMRGTICNPGPRKSMSKLLYIRLALFLPEMVWASLGAAWVA
KGIQCDRTVVIGIIATVIVSWIVIAATMVTIVFVFDPLGGKMAPYPPCIPEHLDSNSSNH
LLTGLRTAAKSVWETRVQCCCCCIGQDDNTRVAFSSTADLFSTYFSDTDLVPSDIAAGFT
LLHQQQDKISHSREPSEVVTHTPGQPQETELDAEVENCHHYMPFAAAAYGWPLYIYRNPF
TGLCRIGGDCCRGRDIEYDAVEGDEHHCHFASILKTTGLQYRDFIHVSFHDKVYELPFIV
VLDHRKESVVVAVRGTMSLQDVLTDLSAESENLELDIELQDCVAHKGIAQAARYIYRRLV
NDGILSQAFSVAPEYRLVVVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLF
EYSKDFVVSLILGMDVIPRLSVANMEDLKRRILRVIANCNKPKYKILLHGCWYSVFGGSP
DNFPTELDEGNQGALTQPLLGEQTLLTRCSPGYCSGDSPLDSPKYPTLYPPGRIIHLEEE
GGSGRFGCCSAAQYRARWAHETEFSKILIGPKMLIDHMPDVMIRALDRVVADRTACVSCP
GQGGSNVP
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgccggggatggtgctgttcggccggcgctggtccctagctagcgacgacctggtgttc
cccgggtcttttgagctgttcctgcgtgtgctgtggtggatcgccagtctgacgttatac
ctcatgcacagaaggaagctggactgtcctggtggggtcttgctcagcacgtacctgatc
gtcctccttgttctcctggctgttattataggcatcgtgctggccatcgtgtgtgtcagc
atgagaggaaccatttgtaaccctggacctcggaagtctatgtctaagctgctctatatc
cgactggccctcttcctgccagagatggtctgggcttctctgggggctgcctgggtggca
aaaggtatccaatgtgacaggacagttgtgattggcatcatcgccaccgtcattgtcagt
tggattgtcatcgctgccactatggtcaccatcgtctttgtctttgacccgctgggtggg
aaaatggctccgtatcccccatgcatccctgaacacctggacagtaacagttcaaaccat
ttattgaccggcctgaggacggctgcaaagagcgtgtgggagacccgggtgcaatgctgc
tgctgctgcattgggcaggacgacaacaccagagtcgccttttccagcacggccgacctg
ttctccacctacttctctgacacagacctggtgcccagcgatattgcagccggcttcacc
cttctccaccagcaacaggacaagatcagccacagccgggagccttcggaggtcgtgacc
cacacaccagggcaacctcaggaaacagagctggacgcggaagtggaaaactgccatcac
tacatgccgtttgcagcagctgcctacggatggcccctctacatctacaggaacccgttc
acggggctgtgcaggatcggtggtgactgctgcagaggcagagacatagagtatgatgcc
gtggaaggtgacgagcaccactgccacttcgcctccatcctgaagacgacggggctgcag
tacagagacttcatccacgttagctttcacgacaaggtgtacgagctgcccttcatagtg
gttctggatcacaggaaggagtctgttgtggttgccgtgagagggaccatgtctctccag
gacgtcctgaccgatctgtctgccgagagcgagaacctagagctggatatcgagctacag
gactgcgtggcccacaagggaattgctcaagcggccagatacatttatcgaagactggtc
aacgatgggattcttagccaagccttcagtgttgctccggagtaccggctcgttgtggtg
gggcacagcctgggagctggagctgcggccctgttagccatcatgctccgcggggcctac
ccacaagtccgtgcttatgccttctccccgcccagggggctgctgagcaaatccctcttt
gagtactccaaggacttcgtggtgtcgctgatcctagggatggatgtgatccccaggtta
agcgtggccaacatggaggatctcaagaggaggatcctgcgagtgatcgccaactgcaat
aagccaaagtacaagatcttgctgcacggctgttggtacagcgtgtttggaggaagccct
gataactttccaaccgaactggatgagggcaaccagggggccctgactcagcctcttcta
ggggagcagactctgctaacacggtgctccccaggctactgctccggcgactccccactg
gattctcccaagtaccccactctgtatccacccggcaggatcatccacctggaagaggag
ggtggttcagggaggtttggctgctgctctgctgcccagtacagagcgaggtgggcacat
gaaacagaattcagcaagatcctgataggcccaaagatgctgattgaccatatgcccgac
gtcatgattcgggccctggacagagtggtcgccgacagaacagcctgtgtctcgtgccct
ggccaaggcggctctaacgtcccttag

DBGET integrated database retrieval system