KEGG   Rattus norvegicus (rat): 304290
Entry
304290            CDS       T01003                                 

Gene name
Kdelr2
Definition
(RefSeq) KDEL endoplasmic reticulum protein retention receptor 2
  KO
K10949  ER lumen protein retaining receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    304290 (Kdelr2)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    304290 (Kdelr2)
SSDB
Motif
Pfam: ER_lumen_recept PQ-loop
Other DBs
NCBI-GeneID: 304290
NCBI-ProteinID: NP_001013140
RGD: 1304618
Ensembl: ENSRNOG00000001083
UniProt: Q5U305
Position
12p11
AA seq 212 aa
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYN
TSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILW
TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIA
VVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaacatcttccggctgactggggacctgtcccacctggcggccatcgtcatcctactg
ctgaagatctggaagacgcgctcctgtgctggtatttctgggaaaagccagctcctgttt
gcactggtcttcacaactcgttacctggatctttttacttcattcatttcgttatataat
acatctatgaagcttatctacattgcctgctcctacgccacggtgtacctgatctacatg
aagtttaaggccacctatgatggaaatcacgacaccttccgagtggagtttcttgtggtt
cctgtaggaggcctctcattcctagtcaaccatgacttctctcctcttgagatcttgtgg
accttctccatctacctggagtccgtggccatcctcccacagctcttcatgatcagcaag
accggcgaggccgagaccatcaccacccactacctcttcttcctgggtctctaccgtgct
ctctacctagtcaactggatctggcgcttctacttcgagggtttctttgatctcattgcc
gtggtggctggtgtcgtccagaccattctctactgcgacttcttctacttgtacatcaca
aaagtactcaagggaaagaagctcagcctgccagcgtaa

DBGET integrated database retrieval system