KEGG   Rattus norvegicus (rat): 304317Help
Entry
304317            CDS       T01003                                 

Gene name
Amz1, RGD1311314
Definition
(RefSeq) archaelysin family metallopeptidase 1
  KO
K06974  archaemetzincin [EC:3.4.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    304317 (Amz1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     304317 (Amz1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M54
   304317 (Amz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M54 DisA-linker
Motif
Other DBs
NCBI-GeneID: 304317
NCBI-ProteinID: NP_001040557
RGD: 1311314
Ensembl: ENSRNOG00000024264
UniProt: Q400C9 B1H214
Position
12q11
AA seq 501 aa AA seqDB search
MVQCRPPQEFSFGPRALKDALISCDLALKQLYTSAFSPSERLFLSEAYNPHRTLFSTLLI
HSAFDWLLSRPEAPEDFETFHASLQLRKQSLARKHIYLQPIDLSEGLAGCPLLDHLRSCA
EAFFLGLRVKCLPSVASASINCCSRPARDTDGLQLHTDGILSFLKNNKPGDALCVLGLTL
ADLYPHDAWTFTFGRFLPGHEVGVCSFARFSGEFLQAGSSIPDSALLEAAAGGPETLPQE
GGQTLCYSALGMVQCCKVTCHELCHLLGLGSCRWLRCLLQGVLSLDEALRRPLDLCPICL
RKLHHLLGFRLLERYKRLHTWTRVMLEMWSGQEAGEPSVSEDTLPFSADSGMGCESDTEP
VTSPSEPVTPDAWSHTFPDGPEPVSEEGLSSLAASEVLLKLGGPVDALEEYRQWLDACIQ
ALEREVAEEELVQVDAAVDALGRWEMFTGQLPVTKQYMPCVKDNVGLRRVLGDKFSSLRR
RLSSRRLAKASSSQCHWGAEN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtgcagaccaccgcaggagttcagctttgggccacgggccctgaaggatgcg
ctgatctcctgcgatctggctctgaagcagctctacacctcagccttctccccgtcggag
aggctcttcctgtctgaggcctacaaccctcaccggactctcttcagcacactgctcatc
cattcagccttcgactggctcctaagccgtccagaggctcctgaggatttcgagaccttc
catgcttctctgcagctccggaagcagagcctggcccggaaacacatttacctgcagccc
atagatctgagtgaggggctggcaggatgccccctgctggaccaccttcgaagctgtgcg
gaggctttcttcctgggccttcgagttaagtgcctgccctctgtagcctctgcctccatt
aactgctgctcaagacccgctcgggacaccgatgggctccagcttcacacagatggcatc
ttgtccttcttgaagaacaacaagccgggggatgcattgtgcgtgctgggcctcacgttg
gccgacctgtacccccatgatgcctggaccttcacctttggcagatttcttccggggcat
gaagtgggtgtgtgtagctttgctcgcttctctggggagttcctgcaggccgggtccagc
attcctgactcagctttgctggaggcagcagcaggtggtcctgagacgttgccacaggag
ggaggacagaccctgtgctacagcgccctgggcatggttcagtgttgcaaggtcacctgc
catgagctctgccacctcctgggcctggggagctgtcgctggctccgctgcctcctgcag
ggggtgcttagcctggatgaggcgctccggcgccctctggacctctgtcctatctgcttg
aggaaactgcaccacctcctgggcttcaggctcctggagaggtacaagagactgcacact
tggactcgggtgatgttggagatgtggtctggtcaagaggccggggagccatctgtgtca
gaggacaccttgcctttcagtgctgactcaggcatgggctgtgagagtgacacggagcct
gtcaccagcccgtcagagcccgtcacccctgatgcgtggagtcatacgtttcctgatggg
cctgaaccagtgtctgaggaaggactgagctccctagcggcctcggaagtgttgctgaaa
ctgggggggcctgtggatgccctggaggaatacagacagtggctggatgcgtgcatccag
gccctggagagggaggtggctgaagaggagctggtccaggtggatgcagccgtggatgcc
ctgggtcggtgggagatgttcacagggcagctaccagtgaccaagcaatacatgccctgt
gtcaaggataatgtgggactgcgcagggtcctgggggacaagttctcttccctgaggcgg
cgactgagctctcgcagacttgccaaggccagttcttcccagtgccactggggggcagag
aattag

DBGET integrated database retrieval system