KEGG   Rattus norvegicus (rat): 304330
Entry
304330            CDS       T01003                                 

Gene name
Cox19, RGD1305631
Definition
(RefSeq) COX19 cytochrome c oxidase assembly factor
  KO
K18183  cytochrome c oxidase assembly protein subunit 19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    304330 (Cox19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    304330 (Cox19)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    304330 (Cox19)
SSDB
Motif
Pfam: CHCH NDUF_B7 Cmc1
Other DBs
NCBI-GeneID: 304330
NCBI-ProteinID: NP_001100596
RGD: 1305631
Ensembl: ENSRNOG00000050052
UniProt: D3ZIS5
Position
12q11
AA seq 92 aa
MSTAMNFGTKSFQPRPPDKGSFPLDHFGECKSFKEKFMKCLRDKNYENALCRNESKEYLM
CRMQRQLMAPEPLEKLGFRDIMEEKPEAKDKC
NT seq 279 nt   +upstreamnt  +downstreamnt
atgtcgaccgcaatgaacttcgggaccaaaagcttccagccgcggcccccagacaaaggc
agcttcccgctagaccacttcggtgagtgtaaaagctttaaggaaaaattcatgaagtgt
ctccgcgacaagaactatgaaaatgctctgtgcagaaatgaatctaaagagtatttaatg
tgcaggatgcaaaggcagctgatggcaccagaaccactagagaaactcggctttagagac
ataatggaggagaaaccggaggcaaaggacaaatgttga

DBGET integrated database retrieval system