KEGG   Rattus norvegicus (rat): 304344
Entry
304344            CDS       T01003                                 

Gene name
Ap4m1
Definition
(RefSeq) adaptor-related protein complex 4, mu 1 subunit
  KO
K12402  AP-4 complex subunit mu-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    304344 (Ap4m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    304344 (Ap4m1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    304344 (Ap4m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 304344
NCBI-ProteinID: NP_001033066
RGD: 1310233
Ensembl: ENSRNOG00000001353
UniProt: Q2PWT8
Position
12q11
AA seq 453 aa
MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGGESPVVMYHDDRHFIHIR
HSGLYLVATTSENVSPFSLLELLSRLATLLGDYCGSLNEGTISRNVALVYELLDEVLDYG
YVQTTSTDMLRNFIQTEAAVSKPFSLFDLSSVGLFGAETQQNRVAPSSAASRPVLSSRSD
QSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSSSEICIGLTEEFCVGKSE
LRGYGPGIRVDEVSFHSSVNLDEFESHRILHLQPPQGELTVMRYQLSDDLPSPLPFRLFP
SVQWDQGSGRLQVYLKLRCDLPPKSQALNIHLHLPLPRGVVSLSQELSSPDQKAELGEGA
LHWDLPRVQGGSQLSGLFQMDVPGLQGPPSRGPSPSAPPLGLGPASLSFELPRHTCSGLQ
VRFLRLSFSACGNANPHKWVRHLSHSNAYVIRI
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgatttcccagttcttcattctgtcttccaagggggatccgctcatctataaagacttc
cgaggggatagtggtggtcgtgatgtggccgagctcttctaccggaagctgacgggactg
ccgggaggcgagtccccggttgtcatgtatcacgatgatcgtcattttattcacatcaga
cacagtggtctctatttggtggccacaacttcagaaaatgtctctcctttcagcctcctg
gagctactttccaggttagccactctcttgggtgactactgtggctcactcaatgagggg
accatctcacggaatgtggcgcttgtctacgaactcctggatgaagtgctggattacggc
tatgtgcagactacgtccacagacatgctgaggaacttcatccaaactgaagccgcggtc
agcaagcctttcagcctcttcgacctcagcagcgtcggtctgtttggggcagagacgcag
cagaacagagtggccccaagcagtgcagccagccgccctgtcctgtccagtcgttctgac
cagagccaaaagaatgaagtgtttttagatgtggtcgaaaggctgtctgttctgattgca
tctaatggctccctgttgaaggtggatgtccaaggagagatccggctcaagagcttcctc
cccagcagttctgagatatgcattggcttgacagaagaattctgtgttggaaagtcagaa
ctgagaggttatgggccagggattcgagttgatgaggtgtcattccatagctctgtcaat
ctagatgagtttgaatctcatcggatcctccacctgcagccgcctcagggcgagctgact
gtgatgagataccagctctctgatgacctcccctcaccacttcccttccggctgtttccc
tctgtacaatgggaccaaggctcaggccggctccaggtttacctgaagttacggtgtgac
ctgcccccaaagagccaagctctcaacattcatctgcaccttcccctgcctcgaggggtc
gtcagcctgtctcaggaactgagcagcccagatcagaaggcagagctgggagaaggagcc
cttcactgggacctgccccgggtacaaggaggttctcaactctctggccttttccagatg
gatgtccctggcttgcagggacctcccagccgtgggccgtccccctcagcaccccccttg
gggctgggtcctgccagcctctcctttgaactccctcggcacacatgctctggcctccag
gttcgattcctcagactgtcctttagcgcctgtggtaatgccaaccctcacaagtgggtt
cgacatctaagccacagcaacgcctacgtaattcggatttga

DBGET integrated database retrieval system